DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl4 and Arl4c

DIOPT Version :9

Sequence 1:NP_001245408.1 Gene:Arl4 / 43771 FlyBaseID:FBgn0039889 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_796279.2 Gene:Arl4c / 320982 MGIID:2445172 Length:192 Species:Mus musculus


Alignment Length:299 Identity:116/299 - (38%)
Similarity:152/299 - (50%) Gaps:109/299 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GNILDALPSQVATLHVVMLGLDSAGKTTALYRLKFDQYLNTVPTIGFNCEKVQCTLGKAKGVHFL 77
            |||...: |...:||:||||||||||||.||||||::::|||||||||.||::.:.|.|||:...
Mouse     2 GNISSNI-SAFQSLHIVMLGLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAKGISCH 65

  Fly    78 VWDVGGQEKLRPLWRSYTRCTDGILFVIDSVDTERMEEAKMELMRTAKCPDNQGVPVLILANKQD 142
            .|||||||||||||:||:||||||::|:||||.:|:||||.||.:..|..:|||.|:|::|||||
Mouse    66 FWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLVIANKQD 130

  Fly   143 LPNACGAMELEKLLGLNELYNPVPNISMPSSSDSSPTINLIGCRVSNQSITDKSLEEKKESHLHS 207
            ||.:....|:||.|.|:||        :|:::                                 
Mouse   131 LPKSLPVAEIEKQLALHEL--------IPATT--------------------------------- 154

  Fly   208 SMIHIKPALESKDHNSTLSGGALTAFIYPQSHNNSAVLDQKNPQDVKNGFHNKKMNRSSSNSVQF 272
                                                                             
Mouse   155 ----------------------------------------------------------------- 154

  Fly   273 RGWYIQPTCAITGEGLQEGLDALYDMILKRRKINKSNKR 311
              :::||.|||.||||.||:|.||:|||||||..|..|:
Mouse   155 --YHVQPACAIIGEGLTEGMDKLYEMILKRRKSLKQKKK 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl4NP_001245408.1 P-loop_NTPase 24..311 CDD:304359 111/286 (39%)
Arl4cNP_796279.2 Arl4_Arl7 11..192 CDD:206719 112/289 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 197 1.000 Domainoid score I3103
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 247 1.000 Inparanoid score I3251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002276
OrthoInspector 1 1.000 - - otm42926
orthoMCL 1 0.900 - - OOG6_106796
Panther 1 1.100 - - O PTHR11711
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5004
SonicParanoid 1 1.000 - - X1505
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.850

Return to query results.
Submit another query.