DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl4 and Arl9

DIOPT Version :9

Sequence 1:NP_001245408.1 Gene:Arl4 / 43771 FlyBaseID:FBgn0039889 Length:313 Species:Drosophila melanogaster
Sequence 2:XP_017454588.1 Gene:Arl9 / 289565 RGDID:1303337 Length:780 Species:Rattus norvegicus


Alignment Length:194 Identity:56/194 - (28%)
Similarity:96/194 - (49%) Gaps:25/194 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SQVATLHVVMLGLDSAGKTTALYRLKFDQYL-NTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQ 84
            ::|....:::||||.||||:.|:.|..:... :|.||:|||...:.   .:.:.:.||  ::||.
  Rat   607 AKVKNKQILVLGLDGAGKTSVLHFLASNTVRHSTAPTLGFNAVNIS---SEDRQMEFL--EIGGS 666

  Fly    85 EKLRPLWRSYTRCTDGILFVIDSVDTERMEEAKMELMRTAKCPDNQGVPVLILANKQ-DLPNACG 148
            |..|..|..|......::||:||.|.:|:.|||..|.:.  ...|..:|:::.|||| ||..|..
  Rat   667 EPFRSYWDMYLPKGWLLIFVVDSADHKRLPEAKKYLHQL--IDPNPDLPLVVFANKQKDLEAAYR 729

  Fly   149 AMELEKLLGLNELYNPVPNISMPSSSDSSPTINLIGCRVS-NQSITDKSLEEKKE--SHLHSSM 209
            ..::...|.|:::.|             ...:.|.|.:|: |.|.....:::.|:  :||..:|
  Rat   730 ITDIHDALALSDVGN-------------DRKLFLFGTQVTRNGSEIPSIMQDAKDLITHLAINM 780

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl4NP_001245408.1 P-loop_NTPase 24..311 CDD:304359 55/191 (29%)
Arl9XP_017454588.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.