DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl4 and arf1

DIOPT Version :9

Sequence 1:NP_001245408.1 Gene:Arl4 / 43771 FlyBaseID:FBgn0039889 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_596118.1 Gene:arf1 / 2540899 PomBaseID:SPBC4F6.18c Length:180 Species:Schizosaccharomyces pombe


Alignment Length:270 Identity:83/270 - (30%)
Similarity:112/270 - (41%) Gaps:114/270 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LHVVMLGLDSAGKTTALYRLKFDQYLNTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPL 90
            :.::|:|||:|||||.||:||..:.:.|:||||||.|.|:     .:.:.|.|||||||:|:|||
pombe    18 MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVE-----YRNISFTVWDVGGQDKIRPL 77

  Fly    91 WRSYTRCTDGILFVIDSVDTERMEEAKMELMRTAKCPDNQGVPVLILANKQDLPNACGAMELEKL 155
            ||.|.:.|.||:||:||.|.||:.||..||.|.....:.:...:|:.|||||||||..|.|:...
pombe    78 WRHYFQNTQGIIFVVDSNDRERISEAHEELQRMLNEDELRDALLLVFANKQDLPNAMNAAEITDK 142

  Fly   156 LGLNELYNPVPNISMPSSSDSSPTINLIGCRVSNQSITDKSLEEKKESHLHSSMIHIKPALESKD 220
            |||                                                              
pombe   143 LGL-------------------------------------------------------------- 145

  Fly   221 HNSTLSGGALTAFIYPQSHNNSAVLDQKNPQDVKNGFHNKKMNRSSSNSVQFRGWYIQPTCAITG 285
                                                           :|::.|.||||.|||.:|
pombe   146 -----------------------------------------------HSLRHRQWYIQATCATSG 163

  Fly   286 EGLQEGLDAL 295
            :||.|||:.|
pombe   164 DGLYEGLEWL 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl4NP_001245408.1 P-loop_NTPase 24..311 CDD:304359 83/270 (31%)
arf1NP_596118.1 P-loop_NTPase 1..180 CDD:304359 83/270 (31%)
SAR 15..174 CDD:197556 83/270 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11711
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.