DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl4 and arf6

DIOPT Version :9

Sequence 1:NP_001245408.1 Gene:Arl4 / 43771 FlyBaseID:FBgn0039889 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_596822.1 Gene:arf6 / 2539937 PomBaseID:SPBC1539.08 Length:184 Species:Schizosaccharomyces pombe


Alignment Length:267 Identity:81/267 - (30%)
Similarity:111/267 - (41%) Gaps:114/267 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LHVVMLGLDSAGKTTALYRLKFDQYLNTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPL 90
            :.::|||||:|||||.||:||.:|.:.|:||:|||.|.|     ..|.:.|.|||||||:|:|||
pombe    22 MRILMLGLDAAGKTTILYKLKLNQSVVTIPTVGFNVETV-----TYKNIKFNVWDVGGQDKIRPL 81

  Fly    91 WRSYTRCTDGILFVIDSVDTERMEEAKMELMRTAKCPDNQGVPVLILANKQDLPNACGAMELEKL 155
            ||.|...|.|::||:||.|:.|:.||:.||.|.....:.:...:|:||||||||.|....::..:
pombe    82 WRHYFTGTKGLIFVVDSADSNRISEARQELHRIISDREMRDCLLLVLANKQDLPGALSPAQITDV 146

  Fly   156 LGLNELYNPVPNISMPSSSDSSPTINLIGCRVSNQSITDKSLEEKKESHLHSSMIHIKPALESKD 220
            |.|::|                                                         ||
pombe   147 LQLDKL---------------------------------------------------------KD 154

  Fly   221 HNSTLSGGALTAFIYPQSHNNSAVLDQKNPQDVKNGFHNKKMNRSSSNSVQFRGWYIQPTCAITG 285
                                                                |.|.:|||||:||
pombe   155 ----------------------------------------------------RLWNVQPTCALTG 167

  Fly   286 EGLQEGL 292
            :||.|||
pombe   168 DGLLEGL 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl4NP_001245408.1 P-loop_NTPase 24..311 CDD:304359 81/267 (30%)
arf6NP_596822.1 Arf6 13..180 CDD:206716 81/267 (30%)
SAR 19..179 CDD:197556 81/267 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.