DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl4 and Arl11

DIOPT Version :9

Sequence 1:NP_001245408.1 Gene:Arl4 / 43771 FlyBaseID:FBgn0039889 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_796311.2 Gene:Arl11 / 219144 MGIID:2444054 Length:176 Species:Mus musculus


Alignment Length:184 Identity:71/184 - (38%)
Similarity:100/184 - (54%) Gaps:24/184 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ATLHVVMLGLDSAGKTTALYRLKFDQYLNTVPTIGFNCEKVQCTLGKAKG-VHFLVWDVGGQEKL 87
            |...|||:|||||||||.||:||.:|.::|:||:|||.|.::     |.| |...:||:|||.:|
Mouse    11 AEAQVVMMGLDSAGKTTILYKLKGNQLVDTLPTVGFNVEPLE-----APGHVSLTLWDIGGQTQL 70

  Fly    88 RPLWRSYTRCTDGILFVIDSVDTERMEEAKMELMRTAKCPDNQGVPVLILANKQDLPNACGAMEL 152
            |..|:.|....|.:::|:||.|..|:.||..||....:.|:..|||.|:|||||:.|.|...:|:
Mouse    71 RATWKDYLEGIDLLVYVLDSTDEARLPEAVAELKEVLEDPNMAGVPFLVLANKQEAPGALPLLEI 135

  Fly   153 EKLLGLNELYNPVPNISMPSSSDSSPTINLIGCRVSNQSITDKSLEEKKESHLH 206
            ...|||...              ......|..|    .::|.:.|:|..:|.||
Mouse   136 RNRLGLEGF--------------QKHCWELRAC----SALTGQGLQEALQSLLH 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl4NP_001245408.1 P-loop_NTPase 24..311 CDD:304359 71/184 (39%)
Arl11NP_796311.2 P-loop_NTPase 14..169 CDD:393306 67/177 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D587782at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.