DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl4 and warf-1

DIOPT Version :9

Sequence 1:NP_001245408.1 Gene:Arl4 / 43771 FlyBaseID:FBgn0039889 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_501242.1 Gene:warf-1 / 191609 WormBaseID:WBGene00000190 Length:179 Species:Caenorhabditis elegans


Alignment Length:135 Identity:68/135 - (50%)
Similarity:87/135 - (64%) Gaps:5/135 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VMLGLDSAGKTTALYRLKFDQYLNTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWRS 93
            :|||||.|||||.||:||.::.:||:||||||.|.|  |..|   :...|||||||:|:|.||:.
 Worm    21 LMLGLDGAGKTTILYKLKLNETVNTIPTIGFNVETV--TFQK---ITLTVWDVGGQKKIRALWKY 80

  Fly    94 YTRCTDGILFVIDSVDTERMEEAKMELMRTAKCPDNQGVPVLILANKQDLPNACGAMELEKLLGL 158
            |...|..::||:||.|.||:.|||.||......|:.....:|:.|||||:|||....||.:||.|
 Worm    81 YFPNTTTLVFVVDSSDIERIPEAKEELFSLLAEPELADSHLLVFANKQDMPNARSPAELTQLLDL 145

  Fly   159 NELYN 163
            ..|.|
 Worm   146 GSLKN 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl4NP_001245408.1 P-loop_NTPase 24..311 CDD:304359 68/135 (50%)
warf-1NP_501242.1 SAR 1..175 CDD:197556 68/135 (50%)
Arf_Arl 19..176 CDD:206644 68/135 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.