DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl4 and arf-5

DIOPT Version :9

Sequence 1:NP_001245408.1 Gene:Arl4 / 43771 FlyBaseID:FBgn0039889 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_501336.1 Gene:arf-5 / 177595 WormBaseID:WBGene00000183 Length:180 Species:Caenorhabditis elegans


Alignment Length:276 Identity:87/276 - (31%)
Similarity:116/276 - (42%) Gaps:114/276 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LHVVMLGLDSAGKTTALYRLKFDQYLNTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPL 90
            :.::|:|||:|||||.||:||..:.:.|:||||||.|.|:     .|.:.|.|||||||:|:|||
 Worm    18 VRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVE-----YKNISFTVWDVGGQDKIRPL 77

  Fly    91 WRSYTRCTDGILFVIDSVDTERMEEAKMELMRTAKCPDNQGVPVLILANKQDLPNACGAMELEKL 155
            ||.|.:.|.|::||:||.|.||:||::.||.:.....:.:...:|:.|||||||||..|.||   
 Worm    78 WRHYFQNTQGLIFVVDSNDKERIEESREELHKMLNEDELRDATLLVFANKQDLPNAMTAAEL--- 139

  Fly   156 LGLNELYNPVPNISMPSSSDSSPTINLIGCRVSNQSITDKSLEEKKESHLHSSMIHIKPALESKD 220
                                                 |||.                        
 Worm   140 -------------------------------------TDKL------------------------ 143

  Fly   221 HNSTLSGGALTAFIYPQSHNNSAVLDQKNPQDVKNGFHNKKMNRSSSNSVQFRGWYIQPTCAITG 285
                                               |.||          ::.|.||||.|||..|
 Worm   144 -----------------------------------GLHN----------LRSRQWYIQATCATQG 163

  Fly   286 EGLQEGLDALYDMILK 301
            .||.||||.|.:.:.|
 Worm   164 HGLYEGLDWLSNQLSK 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl4NP_001245408.1 P-loop_NTPase 24..311 CDD:304359 87/276 (32%)
arf-5NP_501336.1 P-loop_NTPase 1..179 CDD:304359 86/274 (31%)
SAR 15..174 CDD:197556 85/269 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.