DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl4 and arc-1

DIOPT Version :9

Sequence 1:NP_001245408.1 Gene:Arl4 / 43771 FlyBaseID:FBgn0039889 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_496089.3 Gene:arc-1 / 174525 WormBaseID:WBGene00000180 Length:539 Species:Caenorhabditis elegans


Alignment Length:182 Identity:65/182 - (35%)
Similarity:82/182 - (45%) Gaps:49/182 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TMVKPLV-KNGNILD-------------ALP------SQVAT-----------LH--------VV 29
            |:.|.|: :.|.|||             |.|      ||::|           ||        ||
 Worm   309 TLQKALIMERGKILDRKDDLLALAESTAAEPTAVLDQSQLSTRIAFSFLNDRKLHIGDFIESRVV 373

  Fly    30 MLGLDSAGKTTALYRLKFDQYLNTV----PTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPL 90
            :||||.||||:.:.|||..| ::||    ||||||.|.:.     .|......|||||..|||.|
 Worm   374 LLGLDGAGKTSIVRRLKKVQ-MDTVMAPHPTIGFNIETIH-----YKNYRLNFWDVGGLPKLRHL 432

  Fly    91 WRSYTRCTDGILFVIDSVDTERMEEAKMELMRTAKCPDNQGVPVLILANKQD 142
            |:.|......|.:|||....||..||..||.|....|.....||::..|::|
 Worm   433 WKHYYSNAQAIFYVIDGYAVERFSEAIKELNRVMSDPLVGTCPVIVAVNRKD 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl4NP_001245408.1 P-loop_NTPase 24..311 CDD:304359 54/142 (38%)
arc-1NP_496089.3 zf-RING_5 6..54 CDD:291308
zf-B_box 105..149 CDD:279037
Apolipoprotein 201..>306 CDD:279749
BBC 208..339 CDD:128778 8/29 (28%)
Arf_Arl 371..526 CDD:206644 51/120 (43%)
small_GTP 371..526 CDD:272973 51/120 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.