DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl4 and C56E6.2

DIOPT Version :9

Sequence 1:NP_001245408.1 Gene:Arl4 / 43771 FlyBaseID:FBgn0039889 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_495318.2 Gene:C56E6.2 / 174077 WormBaseID:WBGene00016970 Length:266 Species:Caenorhabditis elegans


Alignment Length:241 Identity:60/241 - (24%)
Similarity:94/241 - (39%) Gaps:26/241 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VKPLVKNGNILDALPSQVATL----------HVVMLGLDSAGKTTALYRLKFDQYLNTV-PTIGF 59
            :|.:..:..:.:|:.....|:          .||:||....|||:.:||.::..:...| .||| 
 Worm    23 IKSIYASEKVREAIRDHEQTIATSTAPKHKAKVVVLGDSGVGKTSIIYRHRYGAHYRPVNATIG- 86

  Fly    60 NCEKVQCTLG-----KAKGVHFLVWDVGGQEKLRPLWRSYTRCTDGILFVIDSVDTERMEEAKME 119
             ...|...:|     :...|...|||..|||:.|.:...|.|..|..|.|.|..|....|:.:..
 Worm    87 -ASFVSFDVGADYRDREDVVRLQVWDTAGQERFRCMVPMYMRNADAALIVYDVTDRNTFEDVEKW 150

  Fly   120 LMRTAKCPDNQGVPVLILANKQDLPNACGAMELE-KLLGLN------ELYNPVPNISMPSSSDSS 177
            |....:....:...|.::.||.||.......|.| |.:...      ||.|..||:.....|:.|
 Worm   151 LKDLDRSSGTEDANVYLIGNKTDLVEKREVTEAEGKAMAAKINAKFFELSNDQPNLFAAILSELS 215

  Fly   178 PTINLIGCRVSNQSITDKSLEEKKESHLHSSMIHIKPALESKDHNS 223
            ..: |...:.|::..||..|..|::..|........|.::.|...|
 Worm   216 DDV-LQSRQESSEKKTDLQLIRKEKVSLGDDKFEDNPNIQLKIQKS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl4NP_001245408.1 P-loop_NTPase 24..311 CDD:304359 58/223 (26%)
C56E6.2NP_495318.2 Gem1 50..264 CDD:224025 57/214 (27%)
Rab 54..200 CDD:206640 41/147 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.