DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl4 and Arl5a

DIOPT Version :9

Sequence 1:NP_001245408.1 Gene:Arl4 / 43771 FlyBaseID:FBgn0039889 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_446431.1 Gene:Arl5a / 117050 RGDID:621327 Length:179 Species:Rattus norvegicus


Alignment Length:278 Identity:68/278 - (24%)
Similarity:101/278 - (36%) Gaps:118/278 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VVMLGLDSAGKTTALYRLKFDQYLNTVPTIGFNCEKVQCTLGKAKGVHFLVWDVGGQEKLRPLWR 92
            |:::|||:|||||.||:...::.::|.||||.|.|::     ......||:||:||||.||..|.
  Rat    19 VIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEI-----VVNNTRFLMWDIGGQESLRSSWN 78

  Fly    93 SYTRCTDGILFVIDSVDTERMEEAKMELMRTAKCPDNQGVPVLILANKQDLPNACGAMELEKLLG 157
            :|...|:.::.|:||.|.||:...:.||.:.....|.:...:||.|||||:.......|:.:.|.
  Rat    79 TYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLK 143

  Fly   158 LNELYNPVPNISMPSSSDSSPTINLIGCRVSNQSITDKSLEEKKESHLHSSMIHIKPALESKDHN 222
            |..:                                                         |||.
  Rat   144 LTSI---------------------------------------------------------KDHQ 151

  Fly   223 STLSGGALTAFIYPQSHNNSAVLDQKNPQDVKNGFHNKKMNRSSSNSVQFRGWYIQPTCAITGEG 287
                                                                |:||..||:||||
  Rat   152 ----------------------------------------------------WHIQACCALTGEG 164

  Fly   288 LQEGLDALYDMILKRRKI 305
            |.:||    :.::.|.||
  Rat   165 LCQGL----EWMMSRLKI 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl4NP_001245408.1 P-loop_NTPase 24..311 CDD:304359 68/278 (24%)
Arl5aNP_446431.1 Arl5_Arl8 3..175 CDD:133353 65/273 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.