Sequence 1: | NP_001162819.1 | Gene: | Ank / 43770 | FlyBaseID: | FBgn0011747 | Length: | 1549 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_011748.3 | Gene: | NAS6 / 853147 | SGDID: | S000003464 | Length: | 228 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 227 | Identity: | 64/227 - (28%) |
---|---|---|---|
Similarity: | 104/227 - (45%) | Gaps: | 16/227 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 534 LHIAAKEGQENIVQVLLENGAENNAVTKK---GFTPLHLACKYGKQNVVQILLQNGASI---DFQ 592
Fly 593 GKNDVTPLHVATHYNNPSIVELLLKNGSSPNL--CARNGQCAIHIACKKNYLEIAMQLLQHGADV 655
Fly 656 NIISKSGFSPLHLAAQGGNVDMVQLLLEYG--VISAAAKNGLTPLHVAAQEGHVLVSQILLE-HG 717
Fly 718 ANISERTRNGYTPLHMAAHYGHLDLVKFFIEN 749 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ank | NP_001162819.1 | ANK | 67..192 | CDD:238125 | |
ANK repeat | 72..103 | CDD:293786 | |||
Ank_2 | 77..167 | CDD:289560 | |||
ANK repeat | 105..136 | CDD:293786 | |||
ANK repeat | 138..169 | CDD:293786 | |||
ANK | 204..320 | CDD:238125 | |||
ANK repeat | 204..231 | CDD:293786 | |||
Ank_2 | 205..295 | CDD:289560 | |||
ANK repeat | 233..264 | CDD:293786 | |||
ANK repeat | 266..295 | CDD:293786 | |||
ANK | 294..419 | CDD:238125 | |||
ANK repeat | 299..330 | CDD:293786 | |||
Ank_4 | 300..353 | CDD:290365 | |||
ANK repeat | 332..363 | CDD:293786 | |||
Ank_2 | 337..428 | CDD:289560 | |||
ANK | 360..485 | CDD:238125 | |||
ANK repeat | 365..395 | CDD:293786 | |||
ANK repeat | 398..427 | CDD:293786 | |||
ANK repeat | 431..462 | CDD:293786 | |||
Ank_2 | 436..526 | CDD:289560 | |||
ANK repeat | 464..494 | CDD:293786 | |||
ANK | 491..616 | CDD:238125 | 22/87 (25%) | ||
ANK repeat | 496..527 | CDD:293786 | |||
Ank_2 | 501..592 | CDD:289560 | 16/63 (25%) | ||
ANK repeat | 529..560 | CDD:293786 | 8/25 (32%) | ||
ANK | 557..682 | CDD:238125 | 35/132 (27%) | ||
ANK repeat | 562..590 | CDD:293786 | 7/33 (21%) | ||
Ank_5 | 582..636 | CDD:290568 | 14/58 (24%) | ||
ANK repeat | 595..625 | CDD:293786 | 9/31 (29%) | ||
ANK repeat | 628..657 | CDD:293786 | 9/28 (32%) | ||
Ank_2 | 633..723 | CDD:289560 | 32/92 (35%) | ||
ANK repeat | 661..691 | CDD:293786 | 9/31 (29%) | ||
ANK | 692..812 | CDD:238125 | 19/59 (32%) | ||
ANK repeat | 693..724 | CDD:293786 | 12/31 (39%) | ||
Ank_2 | 698..788 | CDD:289560 | 15/53 (28%) | ||
ANK repeat | 726..755 | CDD:293786 | 6/24 (25%) | ||
ANK repeat | 759..788 | CDD:293786 | |||
ZU5 | 930..1034 | CDD:128514 | |||
Death_ank | 1439..1521 | CDD:260029 | |||
NAS6 | NP_011748.3 | ANKYR | 1..226 | CDD:223738 | 63/224 (28%) |
ANK repeat | 1..33 | CDD:293786 | 8/28 (29%) | ||
ANK repeat | 35..69 | CDD:293786 | 7/33 (21%) | ||
ANK repeat | 71..104 | CDD:293786 | 9/32 (28%) | ||
ANK repeat | 107..137 | CDD:293786 | 10/29 (34%) | ||
ANK repeat | 139..171 | CDD:293786 | 9/31 (29%) | ||
ANK repeat | 173..205 | CDD:293786 | 12/31 (39%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_100012 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |