DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ank and ANK1

DIOPT Version :9

Sequence 1:NP_001162819.1 Gene:Ank / 43770 FlyBaseID:FBgn0011747 Length:1549 Species:Drosophila melanogaster
Sequence 2:NP_001331981.1 Gene:ANK1 / 831855 AraportID:AT5G02620 Length:547 Species:Arabidopsis thaliana


Alignment Length:402 Identity:101/402 - (25%)
Similarity:169/402 - (42%) Gaps:122/402 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 TPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHD--KIVAVLLENDVRGKVRLP 203
            |||:.|.:|                      |.|.|.:.|...||  ::..:|.|.:..|:.   
plant    19 TPLHTAVRE----------------------GKTDLLLEMIGEHDGVELKELLAEQNQSGET--- 58

  Fly   204 ALHIAAKKNDVNAAKLLLQHDPN--ADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYV-AK 265
            ||::||:....:..|:|::|..:  |...:|:||...||||..||:.:..:|:....::::. ..
plant    59 ALYVAAEYGYTDMVKILMKHSDSVLAGTKAKNGFDAFHIAAKNGNLQVLDVLIEANPELSFTFDS 123

  Fly   266 HNITPLHVACKWGKLSLCTLLLCRGAKIDAATR-DGLTPLHCASRSGHVEVIKHLLQQNAPILTK 329
            ...|.||.|...|...:...||.:|..:.|..| :|.|.||.|:|:||..::|.|:::.|.::|:
plant   124 SKTTALHTAASQGHGEIVCFLLDKGVDLAAIARSNGKTALHSAARNGHTVIVKKLIEKKAGMVTR 188

  Fly   330 T-KNGLSALHMAAQGEHDEAAHLLLD------NKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLD 387
            . |.|.:|||||.:|::.|...:|::      |.|                             |
plant   189 VDKKGQTALHMAVKGQNTEIVDVLMEADGSLINSA-----------------------------D 224

  Fly   388 YKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLL 452
            .|.|         ||||||.:|||   .|:::..                  ||.      ::||
plant   225 NKGN---------TPLHIAVRKNR---AEVIVDQ------------------SFK------LFLL 253

  Fly   453 QHEASADLPTIRGETPLHLAARANQADIIRILLRSAKVDAIA--REGQTPLHVASRLGNINIIML 515
            |                .|.:......|::.:|:..:|..:|  :.|:|.|.:|.:.|...|:.|
plant   254 Q----------------KLESFLYSLQIVQTVLKYCEVSRVAVNKSGETALDIAEKTGLHEIVPL 302

  Fly   516 LLQHGAEINAQS 527
            |.:.|.: ||:|
plant   303 LQKIGMQ-NARS 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AnkNP_001162819.1 ANK 67..192 CDD:238125 11/52 (21%)
ANK repeat 72..103 CDD:293786
Ank_2 77..167 CDD:289560 5/25 (20%)
ANK repeat 105..136 CDD:293786
ANK repeat 138..169 CDD:293786 5/27 (19%)
ANK 204..320 CDD:238125 37/119 (31%)
ANK repeat 204..231 CDD:293786 8/28 (29%)
Ank_2 205..295 CDD:289560 25/92 (27%)
ANK repeat 233..264 CDD:293786 9/31 (29%)
ANK repeat 266..295 CDD:293786 8/28 (29%)
ANK 294..419 CDD:238125 39/132 (30%)
ANK repeat 299..330 CDD:293786 12/30 (40%)
Ank_4 300..353 CDD:290365 21/53 (40%)
ANK repeat 332..363 CDD:293786 11/36 (31%)
Ank_2 337..428 CDD:289560 22/96 (23%)
ANK 360..485 CDD:238125 20/124 (16%)
ANK repeat 365..395 CDD:293786 3/29 (10%)
ANK repeat 398..427 CDD:293786 10/28 (36%)
ANK repeat 431..462 CDD:293786 5/30 (17%)
Ank_2 436..526 CDD:289560 20/91 (22%)
ANK repeat 464..494 CDD:293786 4/29 (14%)
ANK 491..616 CDD:238125 13/39 (33%)
ANK repeat 496..527 CDD:293786 11/30 (37%)
Ank_2 501..592 CDD:289560 10/27 (37%)
ANK repeat 529..560 CDD:293786
ANK 557..682 CDD:238125
ANK repeat 562..590 CDD:293786
Ank_5 582..636 CDD:290568
ANK repeat 595..625 CDD:293786
ANK repeat 628..657 CDD:293786
Ank_2 633..723 CDD:289560
ANK repeat 661..691 CDD:293786
ANK 692..812 CDD:238125
ANK repeat 693..724 CDD:293786
Ank_2 698..788 CDD:289560
ANK repeat 726..755 CDD:293786
ANK repeat 759..788 CDD:293786
ZU5 930..1034 CDD:128514
Death_ank 1439..1521 CDD:260029
ANK1NP_001331981.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8400
orthoMCL 1 0.900 - - OOG6_100012
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.