DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ank and TPR10

DIOPT Version :10

Sequence 1:NP_787122.1 Gene:Ank / 43770 FlyBaseID:FBgn0011747 Length:1549 Species:Drosophila melanogaster
Sequence 2:NP_001189808.1 Gene:TPR10 / 819629 AraportID:AT3G04710 Length:680 Species:Arabidopsis thaliana


Alignment Length:476 Identity:122/476 - (25%)
Similarity:195/476 - (40%) Gaps:137/476 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 KKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVA 274
            ||.|.::.|:|...|....:..:        ..|:... :|..:.:|:.|     :|..||:   
plant   153 KKTDSDSVKILCPGDDPQQMKQR--------LRHWAQA-VACSISDNQTD-----RHKQTPV--- 200

  Fly   275 CKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHM 339
                                             |.:|....|::.||     :::||..:||:  
plant   201 ---------------------------------STNGTNSDIQNPLQ-----VSRTKGLVSAM-- 225

  Fly   340 AAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLH 404
                             ||      |..|||     ....||.::|       ||          
plant   226 -----------------AP------DASTAL-----AAREKVQQIL-------NA---------- 245

  Fly   405 IACKKNR--IKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGET 467
             ||..|.  :|.|...:..|.::..|.||    :..|:..|.                       
plant   246 -ACTGNLEFLKNVAKQLDEGKDLTKTVES----IKDANKRGA----------------------- 282

  Fly   468 PLHLAARANQADIIRILLRSAKVDAIARE--GQTPLHVASRLGNINIIMLLLQHGAEINAQSNDK 530
             ||.|||..|.:|.|.||...|::|.|::  |.|||..|:|.|.|..:..||:.||:.|..|...
plant   283 -LHFAAREGQTEICRYLLEELKLNADAKDETGDTPLVHAARQGQIETVKYLLEQGADPNIASELG 346

  Fly   531 YSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKN 595
            .:|||.||..|:..:::.||..|...::.::.| |||..|..:.::|.|::||::.|:.:.:.::
plant   347 ATALHHAAGTGEIELLKELLSRGVPVDSESESG-TPLIWAAGHDQKNAVEVLLEHNANPNAETED 410

  Fly   596 DVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISK 660
            ::|||..|....:.|.:|||:|.|:..|:.| .|...:|||.....||:...||:.|||.|...:
plant   411 NITPLLSAVAAGSLSCLELLVKAGAKANVFA-GGATPLHIAADIGNLELINCLLKAGADPNQKDE 474

  Fly   661 SGFSPLHLAAQGGNVDMVQLL 681
            .|..||.:||...|..:|::|
plant   475 EGNRPLEVAAARDNRKVVEIL 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AnkNP_787122.1 ANKYR 20..337 CDD:440430 21/126 (17%)
ANK repeat 72..103 CDD:293786
ANK repeat 105..136 CDD:293786
ANK repeat 138..169 CDD:293786
ANK repeat 204..231 CDD:293786 6/20 (30%)
ANKYR 217..502 CDD:440430 57/288 (20%)
ANK repeat 233..264 CDD:293786 4/30 (13%)
ANK repeat 266..295 CDD:293786 3/28 (11%)
ANK repeat 299..330 CDD:293786 5/30 (17%)
ANK repeat 332..363 CDD:293786 4/30 (13%)
ANK repeat 365..395 CDD:293786 8/29 (28%)
ANK repeat 398..427 CDD:293786 6/30 (20%)
ANK repeat 431..462 CDD:293786 3/30 (10%)
ANK repeat 464..494 CDD:293786 12/29 (41%)
ANK repeat 496..527 CDD:293786 13/32 (41%)
ANKYR 510..797 CDD:440430 58/172 (34%)
ANK repeat 529..560 CDD:293786 9/30 (30%)
ANK repeat 562..590 CDD:293786 10/27 (37%)
ANK repeat 595..625 CDD:293786 11/29 (38%)
ANK repeat 628..657 CDD:293786 11/28 (39%)
ANK repeat 661..691 CDD:293786 8/21 (38%)
ANK repeat 693..724 CDD:293786
ANK repeat 726..755 CDD:293786
ANK repeat 759..788 CDD:293786
ZU5 930..1034 CDD:128514
UPA_2 1250..1378 CDD:375346
Death_ank 1439..1521 CDD:260029
TPR10NP_001189808.1 DUF1685 82..>125 CDD:462321
ANKYR 232..495 CDD:440430 95/315 (30%)
ANK repeat 282..310 CDD:293786 13/51 (25%)
ANK repeat 313..343 CDD:293786 13/29 (45%)
ANK repeat 345..376 CDD:293786 9/30 (30%)
ANK repeat 378..407 CDD:293786 10/29 (34%)
ANK repeat 410..441 CDD:293786 11/30 (37%)
ANK repeat 442..473 CDD:293786 12/30 (40%)
PLN03088 558..>652 CDD:215568
TPR repeat 585..615 CDD:276809
TPR repeat 620..645 CDD:276809
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.