| Sequence 1: | NP_001162819.1 | Gene: | Ank / 43770 | FlyBaseID: | FBgn0011747 | Length: | 1549 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_180450.2 | Gene: | XBAT31 / 817433 | AraportID: | AT2G28840 | Length: | 456 | Species: | Arabidopsis thaliana |
| Alignment Length: | 254 | Identity: | 75/254 - (29%) |
|---|---|---|---|
| Similarity: | 121/254 - (47%) | Gaps: | 32/254 - (12%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 497 GQTPLH---VASRLGNINIIMLLLQHGAEINAQSN--DKYSALHIAAKEGQENIVQVLLENGAEN 556
Fly 557 NAVTKKGFTPLHLACKYGKQNVVQILLQNGASI-DFQGKNDVTPLHVATHYNNPSIVELLLKNGS 620
Fly 621 SPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYG 685
Fly 686 VISAAAKN-----GLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGH 739 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Ank | NP_001162819.1 | ANK | 67..192 | CDD:238125 | |
| ANK repeat | 72..103 | CDD:293786 | |||
| Ank_2 | 77..167 | CDD:289560 | |||
| ANK repeat | 105..136 | CDD:293786 | |||
| ANK repeat | 138..169 | CDD:293786 | |||
| ANK | 204..320 | CDD:238125 | |||
| ANK repeat | 204..231 | CDD:293786 | |||
| Ank_2 | 205..295 | CDD:289560 | |||
| ANK repeat | 233..264 | CDD:293786 | |||
| ANK repeat | 266..295 | CDD:293786 | |||
| ANK | 294..419 | CDD:238125 | |||
| ANK repeat | 299..330 | CDD:293786 | |||
| Ank_4 | 300..353 | CDD:290365 | |||
| ANK repeat | 332..363 | CDD:293786 | |||
| Ank_2 | 337..428 | CDD:289560 | |||
| ANK | 360..485 | CDD:238125 | |||
| ANK repeat | 365..395 | CDD:293786 | |||
| ANK repeat | 398..427 | CDD:293786 | |||
| ANK repeat | 431..462 | CDD:293786 | |||
| Ank_2 | 436..526 | CDD:289560 | 6/31 (19%) | ||
| ANK repeat | 464..494 | CDD:293786 | |||
| ANK | 491..616 | CDD:238125 | 39/124 (31%) | ||
| ANK repeat | 496..527 | CDD:293786 | 6/32 (19%) | ||
| Ank_2 | 501..592 | CDD:289560 | 29/96 (30%) | ||
| ANK repeat | 529..560 | CDD:293786 | 12/30 (40%) | ||
| ANK | 557..682 | CDD:238125 | 35/125 (28%) | ||
| ANK repeat | 562..590 | CDD:293786 | 12/28 (43%) | ||
| Ank_5 | 582..636 | CDD:290568 | 16/54 (30%) | ||
| ANK repeat | 595..625 | CDD:293786 | 8/29 (28%) | ||
| ANK repeat | 628..657 | CDD:293786 | 3/28 (11%) | ||
| Ank_2 | 633..723 | CDD:289560 | 28/94 (30%) | ||
| ANK repeat | 661..691 | CDD:293786 | 11/29 (38%) | ||
| ANK | 692..812 | CDD:238125 | 17/53 (32%) | ||
| ANK repeat | 693..724 | CDD:293786 | 12/35 (34%) | ||
| Ank_2 | 698..788 | CDD:289560 | 14/42 (33%) | ||
| ANK repeat | 726..755 | CDD:293786 | 4/14 (29%) | ||
| ANK repeat | 759..788 | CDD:293786 | |||
| ZU5 | 930..1034 | CDD:128514 | |||
| Death_ank | 1439..1521 | CDD:260029 | |||
| XBAT31 | NP_180450.2 | ANK repeat | 44..76 | CDD:293786 | 12/31 (39%) |
| Ank_2 | 50..134 | CDD:372319 | 30/83 (36%) | ||
| ANK repeat | 78..109 | CDD:293786 | 12/30 (40%) | ||
| ANK repeat | 112..155 | CDD:293786 | 14/63 (22%) | ||
| Ank_2 | 117..225 | CDD:372319 | 36/128 (28%) | ||
| ANK repeat | 157..186 | CDD:293786 | 11/28 (39%) | ||
| ANK repeat | 194..219 | CDD:293786 | 10/24 (42%) | ||
| RING-HC_malin | 318..368 | CDD:319430 | |||
| RING-HC finger (C3HC4-type) | 319..367 | CDD:319430 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG4177 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 1 | 1.000 | - | - | otm3248 | |
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.810 | |||||