| Sequence 1: | NP_001162819.1 | Gene: | Ank / 43770 | FlyBaseID: | FBgn0011747 | Length: | 1549 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_178442.2 | Gene: | AT2G03430 / 814872 | AraportID: | AT2G03430 | Length: | 240 | Species: | Arabidopsis thaliana |
| Alignment Length: | 228 | Identity: | 70/228 - (30%) |
|---|---|---|---|
| Similarity: | 110/228 - (48%) | Gaps: | 44/228 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 465 GETPLHLAARANQADIIRILLRSAKVDAIAR----EGQTPLHVASRLGNINIIMLLLQHGAEINA 525
Fly 526 QSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASID 590
Fly 591 FQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAI--HIACKKNYLEIAMQLLQHGA 653
Fly 654 DVNIISKSGFSPLHLAA---QGGNVDMVQLLLE 683 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Ank | NP_001162819.1 | ANK | 67..192 | CDD:238125 | |
| ANK repeat | 72..103 | CDD:293786 | |||
| Ank_2 | 77..167 | CDD:289560 | |||
| ANK repeat | 105..136 | CDD:293786 | |||
| ANK repeat | 138..169 | CDD:293786 | |||
| ANK | 204..320 | CDD:238125 | |||
| ANK repeat | 204..231 | CDD:293786 | |||
| Ank_2 | 205..295 | CDD:289560 | |||
| ANK repeat | 233..264 | CDD:293786 | |||
| ANK repeat | 266..295 | CDD:293786 | |||
| ANK | 294..419 | CDD:238125 | |||
| ANK repeat | 299..330 | CDD:293786 | |||
| Ank_4 | 300..353 | CDD:290365 | |||
| ANK repeat | 332..363 | CDD:293786 | |||
| Ank_2 | 337..428 | CDD:289560 | |||
| ANK | 360..485 | CDD:238125 | 6/19 (32%) | ||
| ANK repeat | 365..395 | CDD:293786 | |||
| ANK repeat | 398..427 | CDD:293786 | |||
| ANK repeat | 431..462 | CDD:293786 | |||
| Ank_2 | 436..526 | CDD:289560 | 21/64 (33%) | ||
| ANK repeat | 464..494 | CDD:293786 | 8/28 (29%) | ||
| ANK | 491..616 | CDD:238125 | 44/128 (34%) | ||
| ANK repeat | 496..527 | CDD:293786 | 14/30 (47%) | ||
| Ank_2 | 501..592 | CDD:289560 | 40/90 (44%) | ||
| ANK repeat | 529..560 | CDD:293786 | 13/30 (43%) | ||
| ANK | 557..682 | CDD:238125 | 33/129 (26%) | ||
| ANK repeat | 562..590 | CDD:293786 | 12/27 (44%) | ||
| Ank_5 | 582..636 | CDD:290568 | 9/55 (16%) | ||
| ANK repeat | 595..625 | CDD:293786 | 0/29 (0%) | ||
| ANK repeat | 628..657 | CDD:293786 | 11/30 (37%) | ||
| Ank_2 | 633..723 | CDD:289560 | 15/56 (27%) | ||
| ANK repeat | 661..691 | CDD:293786 | 6/26 (23%) | ||
| ANK | 692..812 | CDD:238125 | |||
| ANK repeat | 693..724 | CDD:293786 | |||
| Ank_2 | 698..788 | CDD:289560 | |||
| ANK repeat | 726..755 | CDD:293786 | |||
| ANK repeat | 759..788 | CDD:293786 | |||
| ZU5 | 930..1034 | CDD:128514 | |||
| Death_ank | 1439..1521 | CDD:260029 | |||
| AT2G03430 | NP_178442.2 | ANKYR | 13..210 | CDD:223738 | 63/197 (32%) |
| ANK repeat | 46..80 | CDD:293786 | 8/32 (25%) | ||
| ANK repeat | 82..113 | CDD:293786 | 14/30 (47%) | ||
| Ank_2 | 87..179 | CDD:403870 | 40/91 (44%) | ||
| ANK repeat | 115..146 | CDD:293786 | 13/30 (43%) | ||
| ANK repeat | 148..179 | CDD:293786 | 14/30 (47%) | ||
| ANK repeat | 181..212 | CDD:293786 | 11/32 (34%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 1 | 1.000 | - | - | otm2871 | |
| orthoMCL | 1 | 0.900 | - | - | OOG6_100012 | |
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.810 | |||||