DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ank and ANKDD1B

DIOPT Version :9

Sequence 1:NP_001162819.1 Gene:Ank / 43770 FlyBaseID:FBgn0011747 Length:1549 Species:Drosophila melanogaster
Sequence 2:XP_016865303.1 Gene:ANKDD1B / 728780 HGNCID:32525 Length:563 Species:Homo sapiens


Alignment Length:412 Identity:109/412 - (26%)
Similarity:193/412 - (46%) Gaps:43/412 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   343 GEHDEAA---HLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLH 404
            ||.|.|.   .|||.|:           .:...||...::.:.:.|.:.|.|.|.......|.||
Human    53 GEEDTAVAGHELLLPNE-----------RSFQNAAKSNNLDLMEKLFEKKVNINVVNNMNRTALH 106

  Fly   405 IACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGE--- 466
            .|..:|.:..|:.|:||.|.:....:.|||.:|:|::.|.:.:::.|:  :|.||.   |.:   
Human   107 FAVGRNHLSAVDFLLKHKARVDVADKHGLTVIHLAAWSGSLEVMLMLV--KAGADQ---RAKNQV 166

  Fly   467 ----TPLH--LAARANQADIIRILLRSAKVDAIAREGQTPLHVASRLGNINIIMLLLQ--HGAEI 523
                ||..  |.....:.:::|.|..|....:: ::|.:.||.|::..::.|:..|:|  |..::
Human   167 GMWVTPGQKLLPHHCRREEVLRSLSISPTPGSL-QDGMSALHFATQSNHVRIVEYLIQDLHLKDL 230

  Fly   524 NAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGAS 588
            |...........:||:.|...:::.|.......:...|.|.|.||||.|:|....||:||.....
Human   231 NQPDEKGRKPFLLAAERGHVEMIEKLTFLNLHTSEKDKGGNTALHLAAKHGHSPAVQVLLAQWQD 295

  Fly   589 IDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGA 653
            |:...:.:::.|.:||...:.|:|..||......:......:..:|:....|::.:...||....
Human   296 INEMNELNISSLQIATRNGHASLVNFLLSENVDLHQKVEPKESPLHLVVINNHITVVNSLLSAQH 360

  Fly   654 DVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILL--- 714
            |::|:::...:|||:||..|||::|:.||:.|. :.|..|.|.|.|.||::..|.||..:|:   
Human   361 DIDILNQKQQTPLHVAADRGNVELVETLLKAGCDLKAVDKQGKTALAVASRSNHSLVVGMLIKAE 425

  Fly   715 -------EHGANISERTRNGYT 729
                   ||..:|.:.: .|:|
Human   426 RYYAWREEHHESIRDPS-TGFT 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AnkNP_001162819.1 ANK 67..192 CDD:238125
ANK repeat 72..103 CDD:293786
Ank_2 77..167 CDD:289560
ANK repeat 105..136 CDD:293786
ANK repeat 138..169 CDD:293786
ANK 204..320 CDD:238125
ANK repeat 204..231 CDD:293786
Ank_2 205..295 CDD:289560
ANK repeat 233..264 CDD:293786
ANK repeat 266..295 CDD:293786
ANK 294..419 CDD:238125 20/78 (26%)
ANK repeat 299..330 CDD:293786
Ank_4 300..353 CDD:290365 5/12 (42%)
ANK repeat 332..363 CDD:293786 8/22 (36%)
Ank_2 337..428 CDD:289560 24/87 (28%)
ANK 360..485 CDD:238125 31/133 (23%)
ANK repeat 365..395 CDD:293786 6/29 (21%)
ANK repeat 398..427 CDD:293786 10/28 (36%)
ANK repeat 431..462 CDD:293786 10/30 (33%)
Ank_2 436..526 CDD:289560 23/100 (23%)
ANK repeat 464..494 CDD:293786 7/38 (18%)
ANK 491..616 CDD:238125 32/126 (25%)
ANK repeat 496..527 CDD:293786 9/32 (28%)
Ank_2 501..592 CDD:289560 26/92 (28%)
ANK repeat 529..560 CDD:293786 4/30 (13%)
ANK 557..682 CDD:238125 36/124 (29%)
ANK repeat 562..590 CDD:293786 12/27 (44%)
Ank_5 582..636 CDD:290568 11/53 (21%)
ANK repeat 595..625 CDD:293786 7/29 (24%)
ANK repeat 628..657 CDD:293786 5/28 (18%)
Ank_2 633..723 CDD:289560 32/100 (32%)
ANK repeat 661..691 CDD:293786 13/30 (43%)
ANK 692..812 CDD:238125 15/48 (31%)
ANK repeat 693..724 CDD:293786 12/40 (30%)
Ank_2 698..788 CDD:289560 12/42 (29%)
ANK repeat 726..755 CDD:293786 2/4 (50%)
ANK repeat 759..788 CDD:293786
ZU5 930..1034 CDD:128514
Death_ank 1439..1521 CDD:260029
ANKDD1BXP_016865303.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.