DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ank and Ankrd65

DIOPT Version :9

Sequence 1:NP_001162819.1 Gene:Ank / 43770 FlyBaseID:FBgn0011747 Length:1549 Species:Drosophila melanogaster
Sequence 2:NP_001102897.1 Gene:Ankrd65 / 680734 RGDID:1588232 Length:365 Species:Rattus norvegicus


Alignment Length:400 Identity:121/400 - (30%)
Similarity:172/400 - (43%) Gaps:101/400 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 ITP-----LHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPIL 327
            :||     |..|..||..||...||.:||.::.....|.||||.|...||..:::.|||:.|   
  Rat    29 LTPQGWSTLFQAVWWGAPSLVMQLLRQGASVEERDHTGRTPLHLAVMRGHAPLVRLLLQRGA--- 90

  Fly   328 TKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANP 392
                       :|...:|...                   |.||.||..||..||          
  Rat    91 -----------LAGAVDHTGR-------------------TPLHEAAWHGHSNVA---------- 115

  Fly   393 NARALNGFTPLHIACKKNRIKMVELLIKHGANIGA-TTESGLTPLHVASFMG-CINIVIYLLQHE 455
                                   |||::.||:..| .:::||||||.|:.:| .:.:..:....:
  Rat   116 -----------------------ELLLRRGASAAAPCSQTGLTPLHGAAALGRTLLVTCFTAAPD 157

  Fly   456 ASADLPTIRGETPLHLAARANQ---------------------------ADIIRILLR-SAKVDA 492
            :..|:..|||.|..|.||...|                           |..:|:||. .|||||
  Rat   158 SVPDVKDIRGWTATHWAAACGQLPVLELLTAGGSVDLDGALLVSAVAGSASALRLLLTLGAKVDA 222

  Fly   493 IAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENN 557
            :...|.|.|.:|:.||:...|.:||.|||:.|.:..:..||||.||..|....:|:|:..|.:.:
  Rat   223 LDSTGATALGLAAGLGHHQEIEVLLGHGADPNIRDRNNRSALHRAASGGCLRAIQLLVAKGTDVD 287

  Fly   558 AVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSP 622
            |....|.||||.|.:.|.:.||..||..||.:|..|....||||:|....:.:|:||||..|::|
  Rat   288 ARDSLGLTPLHYAARGGHREVVSHLLDRGAHVDAAGWLHKTPLHLAVECGHTTILELLLSRGANP 352

  Fly   623 NLCARNGQCA 632
            :|..:.|:.|
  Rat   353 SLRTQWGEVA 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AnkNP_001162819.1 ANK 67..192 CDD:238125
ANK repeat 72..103 CDD:293786
Ank_2 77..167 CDD:289560
ANK repeat 105..136 CDD:293786
ANK repeat 138..169 CDD:293786
ANK 204..320 CDD:238125 20/56 (36%)
ANK repeat 204..231 CDD:293786
Ank_2 205..295 CDD:289560 12/31 (39%)
ANK repeat 233..264 CDD:293786
ANK repeat 266..295 CDD:293786 12/31 (39%)
ANK 294..419 CDD:238125 25/124 (20%)
ANK repeat 299..330 CDD:293786 12/30 (40%)
Ank_4 300..353 CDD:290365 14/52 (27%)
ANK repeat 332..363 CDD:293786 2/30 (7%)
Ank_2 337..428 CDD:289560 17/91 (19%)
ANK 360..485 CDD:238125 34/153 (22%)
ANK repeat 365..395 CDD:293786 9/29 (31%)
ANK repeat 398..427 CDD:293786 5/28 (18%)
ANK repeat 431..462 CDD:293786 9/31 (29%)
Ank_2 436..526 CDD:289560 35/118 (30%)
ANK repeat 464..494 CDD:293786 16/57 (28%)
ANK 491..616 CDD:238125 49/124 (40%)
ANK repeat 496..527 CDD:293786 13/30 (43%)
Ank_2 501..592 CDD:289560 36/90 (40%)
ANK repeat 529..560 CDD:293786 11/30 (37%)
ANK 557..682 CDD:238125 30/75 (40%)
ANK repeat 562..590 CDD:293786 13/27 (48%)
Ank_5 582..636 CDD:290568 20/50 (40%)
ANK repeat 595..625 CDD:293786 12/29 (41%)
ANK repeat 628..657 CDD:293786 1/4 (25%)
Ank_2 633..723 CDD:289560 120/399 (30%)
ANK repeat 661..691 CDD:293786
ANK 692..812 CDD:238125
ANK repeat 693..724 CDD:293786
Ank_2 698..788 CDD:289560
ANK repeat 726..755 CDD:293786
ANK repeat 759..788 CDD:293786
ZU5 930..1034 CDD:128514
Death_ank 1439..1521 CDD:260029
Ankrd65NP_001102897.1 ANK 33..149 CDD:238125 47/181 (26%)
ANK repeat 33..63 CDD:293786 10/29 (34%)
Ank_2 37..123 CDD:289560 36/151 (24%)
ANK repeat 65..96 CDD:293786 13/44 (30%)
ANK repeat 98..123 CDD:293786 12/76 (16%)
ANK repeat 197..224 CDD:293786 9/26 (35%)
Ank_2 198..290 CDD:289560 33/91 (36%)
ANK 221..346 CDD:238125 49/124 (40%)
ANK repeat 227..257 CDD:293786 13/29 (45%)
ANK repeat 259..290 CDD:293786 11/30 (37%)
Ank_2 264..355 CDD:289560 36/90 (40%)
ANK repeat 292..323 CDD:293786 14/30 (47%)
ANK repeat 325..355 CDD:293786 12/29 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.