Sequence 1: | NP_001162819.1 | Gene: | Ank / 43770 | FlyBaseID: | FBgn0011747 | Length: | 1549 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001102897.1 | Gene: | Ankrd65 / 680734 | RGDID: | 1588232 | Length: | 365 | Species: | Rattus norvegicus |
Alignment Length: | 400 | Identity: | 121/400 - (30%) |
---|---|---|---|
Similarity: | 172/400 - (43%) | Gaps: | 101/400 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 268 ITP-----LHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPIL 327
Fly 328 TKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANP 392
Fly 393 NARALNGFTPLHIACKKNRIKMVELLIKHGANIGA-TTESGLTPLHVASFMG-CINIVIYLLQHE 455
Fly 456 ASADLPTIRGETPLHLAARANQ---------------------------ADIIRILLR-SAKVDA 492
Fly 493 IAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENN 557
Fly 558 AVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSP 622
Fly 623 NLCARNGQCA 632 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ank | NP_001162819.1 | ANK | 67..192 | CDD:238125 | |
ANK repeat | 72..103 | CDD:293786 | |||
Ank_2 | 77..167 | CDD:289560 | |||
ANK repeat | 105..136 | CDD:293786 | |||
ANK repeat | 138..169 | CDD:293786 | |||
ANK | 204..320 | CDD:238125 | 20/56 (36%) | ||
ANK repeat | 204..231 | CDD:293786 | |||
Ank_2 | 205..295 | CDD:289560 | 12/31 (39%) | ||
ANK repeat | 233..264 | CDD:293786 | |||
ANK repeat | 266..295 | CDD:293786 | 12/31 (39%) | ||
ANK | 294..419 | CDD:238125 | 25/124 (20%) | ||
ANK repeat | 299..330 | CDD:293786 | 12/30 (40%) | ||
Ank_4 | 300..353 | CDD:290365 | 14/52 (27%) | ||
ANK repeat | 332..363 | CDD:293786 | 2/30 (7%) | ||
Ank_2 | 337..428 | CDD:289560 | 17/91 (19%) | ||
ANK | 360..485 | CDD:238125 | 34/153 (22%) | ||
ANK repeat | 365..395 | CDD:293786 | 9/29 (31%) | ||
ANK repeat | 398..427 | CDD:293786 | 5/28 (18%) | ||
ANK repeat | 431..462 | CDD:293786 | 9/31 (29%) | ||
Ank_2 | 436..526 | CDD:289560 | 35/118 (30%) | ||
ANK repeat | 464..494 | CDD:293786 | 16/57 (28%) | ||
ANK | 491..616 | CDD:238125 | 49/124 (40%) | ||
ANK repeat | 496..527 | CDD:293786 | 13/30 (43%) | ||
Ank_2 | 501..592 | CDD:289560 | 36/90 (40%) | ||
ANK repeat | 529..560 | CDD:293786 | 11/30 (37%) | ||
ANK | 557..682 | CDD:238125 | 30/75 (40%) | ||
ANK repeat | 562..590 | CDD:293786 | 13/27 (48%) | ||
Ank_5 | 582..636 | CDD:290568 | 20/50 (40%) | ||
ANK repeat | 595..625 | CDD:293786 | 12/29 (41%) | ||
ANK repeat | 628..657 | CDD:293786 | 1/4 (25%) | ||
Ank_2 | 633..723 | CDD:289560 | 120/399 (30%) | ||
ANK repeat | 661..691 | CDD:293786 | |||
ANK | 692..812 | CDD:238125 | |||
ANK repeat | 693..724 | CDD:293786 | |||
Ank_2 | 698..788 | CDD:289560 | |||
ANK repeat | 726..755 | CDD:293786 | |||
ANK repeat | 759..788 | CDD:293786 | |||
ZU5 | 930..1034 | CDD:128514 | |||
Death_ank | 1439..1521 | CDD:260029 | |||
Ankrd65 | NP_001102897.1 | ANK | 33..149 | CDD:238125 | 47/181 (26%) |
ANK repeat | 33..63 | CDD:293786 | 10/29 (34%) | ||
Ank_2 | 37..123 | CDD:289560 | 36/151 (24%) | ||
ANK repeat | 65..96 | CDD:293786 | 13/44 (30%) | ||
ANK repeat | 98..123 | CDD:293786 | 12/76 (16%) | ||
ANK repeat | 197..224 | CDD:293786 | 9/26 (35%) | ||
Ank_2 | 198..290 | CDD:289560 | 33/91 (36%) | ||
ANK | 221..346 | CDD:238125 | 49/124 (40%) | ||
ANK repeat | 227..257 | CDD:293786 | 13/29 (45%) | ||
ANK repeat | 259..290 | CDD:293786 | 11/30 (37%) | ||
Ank_2 | 264..355 | CDD:289560 | 36/90 (40%) | ||
ANK repeat | 292..323 | CDD:293786 | 14/30 (47%) | ||
ANK repeat | 325..355 | CDD:293786 | 12/29 (41%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG4177 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |