Sequence 1: | NP_001162819.1 | Gene: | Ank / 43770 | FlyBaseID: | FBgn0011747 | Length: | 1549 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001092718.1 | Gene: | ankdd1a / 569271 | ZFINID: | ZDB-GENE-070615-8 | Length: | 489 | Species: | Danio rerio |
Alignment Length: | 382 | Identity: | 104/382 - (27%) |
---|---|---|---|
Similarity: | 191/382 - (50%) | Gaps: | 36/382 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 305 HCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTA 369
Fly 370 LHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLT 434
Fly 435 PLHVASFMGCINIVIYLLQHEASADLPTIR--GETPLHLAARANQADIIRILLRSAKVDAIA-RE 496
Fly 497 GQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTK 561
Fly 562 KGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCA 626
Fly 627 RNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLE 683 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ank | NP_001162819.1 | ANK | 67..192 | CDD:238125 | |
ANK repeat | 72..103 | CDD:293786 | |||
Ank_2 | 77..167 | CDD:289560 | |||
ANK repeat | 105..136 | CDD:293786 | |||
ANK repeat | 138..169 | CDD:293786 | |||
ANK | 204..320 | CDD:238125 | 3/14 (21%) | ||
ANK repeat | 204..231 | CDD:293786 | |||
Ank_2 | 205..295 | CDD:289560 | |||
ANK repeat | 233..264 | CDD:293786 | |||
ANK repeat | 266..295 | CDD:293786 | |||
ANK | 294..419 | CDD:238125 | 26/113 (23%) | ||
ANK repeat | 299..330 | CDD:293786 | 5/24 (21%) | ||
Ank_4 | 300..353 | CDD:290365 | 14/47 (30%) | ||
ANK repeat | 332..363 | CDD:293786 | 12/30 (40%) | ||
Ank_2 | 337..428 | CDD:289560 | 21/90 (23%) | ||
ANK | 360..485 | CDD:238125 | 27/126 (21%) | ||
ANK repeat | 365..395 | CDD:293786 | 7/29 (24%) | ||
ANK repeat | 398..427 | CDD:293786 | 3/28 (11%) | ||
ANK repeat | 431..462 | CDD:293786 | 10/30 (33%) | ||
Ank_2 | 436..526 | CDD:289560 | 23/92 (25%) | ||
ANK repeat | 464..494 | CDD:293786 | 7/31 (23%) | ||
ANK | 491..616 | CDD:238125 | 36/125 (29%) | ||
ANK repeat | 496..527 | CDD:293786 | 8/30 (27%) | ||
Ank_2 | 501..592 | CDD:289560 | 27/90 (30%) | ||
ANK repeat | 529..560 | CDD:293786 | 11/30 (37%) | ||
ANK | 557..682 | CDD:238125 | 40/124 (32%) | ||
ANK repeat | 562..590 | CDD:293786 | 8/27 (30%) | ||
Ank_5 | 582..636 | CDD:290568 | 16/53 (30%) | ||
ANK repeat | 595..625 | CDD:293786 | 9/29 (31%) | ||
ANK repeat | 628..657 | CDD:293786 | 10/28 (36%) | ||
Ank_2 | 633..723 | CDD:289560 | 18/51 (35%) | ||
ANK repeat | 661..691 | CDD:293786 | 8/23 (35%) | ||
ANK | 692..812 | CDD:238125 | |||
ANK repeat | 693..724 | CDD:293786 | |||
Ank_2 | 698..788 | CDD:289560 | |||
ANK repeat | 726..755 | CDD:293786 | |||
ANK repeat | 759..788 | CDD:293786 | |||
ZU5 | 930..1034 | CDD:128514 | |||
Death_ank | 1439..1521 | CDD:260029 | |||
ankdd1a | NP_001092718.1 | ANK | 19..134 | CDD:238125 | 38/146 (26%) |
Ank_2 | 19..111 | CDD:289560 | 29/123 (24%) | ||
ANK repeat | 19..45 | CDD:293786 | 5/24 (21%) | ||
ANK repeat | 47..78 | CDD:293786 | 12/30 (40%) | ||
ANK | 79..202 | CDD:238125 | 33/155 (21%) | ||
ANK repeat | 80..111 | CDD:293786 | 10/63 (16%) | ||
Ank_2 | 85..179 | CDD:289560 | 26/126 (21%) | ||
ANK repeat | 113..146 | CDD:293786 | 10/32 (31%) | ||
ANK | 143..268 | CDD:238125 | 32/124 (26%) | ||
ANK repeat | 148..179 | CDD:293786 | 7/30 (23%) | ||
Ank_2 | 153..242 | CDD:289560 | 23/88 (26%) | ||
ANK repeat | 181..212 | CDD:293786 | 8/30 (27%) | ||
ANK | 209..334 | CDD:238125 | 38/124 (31%) | ||
ANK repeat | 214..242 | CDD:293786 | 10/27 (37%) | ||
ANK repeat | 247..278 | CDD:293786 | 9/30 (30%) | ||
Ank_2 | 252..344 | CDD:289560 | 28/91 (31%) | ||
ANK repeat | 280..311 | CDD:293786 | 9/30 (30%) | ||
ANK repeat | 313..344 | CDD:293786 | 11/30 (37%) | ||
DD | 402..474 | CDD:301326 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |