DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ank and ankdd1a

DIOPT Version :9

Sequence 1:NP_001162819.1 Gene:Ank / 43770 FlyBaseID:FBgn0011747 Length:1549 Species:Drosophila melanogaster
Sequence 2:NP_001092718.1 Gene:ankdd1a / 569271 ZFINID:ZDB-GENE-070615-8 Length:489 Species:Danio rerio


Alignment Length:382 Identity:104/382 - (27%)
Similarity:191/382 - (50%) Gaps:36/382 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 HCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTA 369
            |.|::....|.::.|:.:...|..|.|....|||.||....::|..||||:...||::....:.|
Zfish    20 HDAAKRNDTERMQELISRGVDIKVKNKMDRKALHWAAGAGSEQALRLLLDHDMDVDDMDSFGMNA 84

  Fly   370 LHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLT 434
            |.:||..||:.:.|                                 :|:..||.:....::||.
Zfish    85 LLLAAWFGHLTILK---------------------------------ILVSTGAKLTTENKNGLN 116

  Fly   435 PLHVASFMGCINIVIYLLQHEASADLPTIR--GETPLHLAARANQADIIRILLRSAKVDAIA-RE 496
            .||.|:..|.|.|:.|:::...:..|..:.  |:|..||||.....:::..|:.......:. :.
Zfish   117 LLHCAAQRGHITILEYIMEDLENVQLNKVENSGKTAFHLAAEHGHLEVVEFLIGMGCAHNLKDKH 181

  Fly   497 GQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTK 561
            |.|.||:|::.|:.:::..:::.|..|:.::.|..:|||:|::.|....:::|||.|...|.:|.
Zfish   182 GNTALHLAAKQGHSDVLQKIMETGENIDERNIDGMTALHLASEGGHYECIRLLLEAGCNVNELTD 246

  Fly   562 KGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCA 626
            ...|.|||..::...:.|::|:|.|.::|......|:.||:|...|:..||:.|::.|...::..
Zfish   247 SKRTALHLVAQHASASEVRLLIQAGINLDSVDTQHVSALHLAVLNNSTEIVKDLIEAGCDLDIFD 311

  Fly   627 RNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLE 683
            ...|.|:|||.:...|.||..:|..|.::|::.|.|.|.|.:||:|.:|::|.::::
Zfish   312 NRLQTALHIAAEHGRLNIAETILISGVNLNLLDKQGKSSLDVAARGNHVNVVDMIIK 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AnkNP_001162819.1 ANK 67..192 CDD:238125
ANK repeat 72..103 CDD:293786
Ank_2 77..167 CDD:289560
ANK repeat 105..136 CDD:293786
ANK repeat 138..169 CDD:293786
ANK 204..320 CDD:238125 3/14 (21%)
ANK repeat 204..231 CDD:293786
Ank_2 205..295 CDD:289560
ANK repeat 233..264 CDD:293786
ANK repeat 266..295 CDD:293786
ANK 294..419 CDD:238125 26/113 (23%)
ANK repeat 299..330 CDD:293786 5/24 (21%)
Ank_4 300..353 CDD:290365 14/47 (30%)
ANK repeat 332..363 CDD:293786 12/30 (40%)
Ank_2 337..428 CDD:289560 21/90 (23%)
ANK 360..485 CDD:238125 27/126 (21%)
ANK repeat 365..395 CDD:293786 7/29 (24%)
ANK repeat 398..427 CDD:293786 3/28 (11%)
ANK repeat 431..462 CDD:293786 10/30 (33%)
Ank_2 436..526 CDD:289560 23/92 (25%)
ANK repeat 464..494 CDD:293786 7/31 (23%)
ANK 491..616 CDD:238125 36/125 (29%)
ANK repeat 496..527 CDD:293786 8/30 (27%)
Ank_2 501..592 CDD:289560 27/90 (30%)
ANK repeat 529..560 CDD:293786 11/30 (37%)
ANK 557..682 CDD:238125 40/124 (32%)
ANK repeat 562..590 CDD:293786 8/27 (30%)
Ank_5 582..636 CDD:290568 16/53 (30%)
ANK repeat 595..625 CDD:293786 9/29 (31%)
ANK repeat 628..657 CDD:293786 10/28 (36%)
Ank_2 633..723 CDD:289560 18/51 (35%)
ANK repeat 661..691 CDD:293786 8/23 (35%)
ANK 692..812 CDD:238125
ANK repeat 693..724 CDD:293786
Ank_2 698..788 CDD:289560
ANK repeat 726..755 CDD:293786
ANK repeat 759..788 CDD:293786
ZU5 930..1034 CDD:128514
Death_ank 1439..1521 CDD:260029
ankdd1aNP_001092718.1 ANK 19..134 CDD:238125 38/146 (26%)
Ank_2 19..111 CDD:289560 29/123 (24%)
ANK repeat 19..45 CDD:293786 5/24 (21%)
ANK repeat 47..78 CDD:293786 12/30 (40%)
ANK 79..202 CDD:238125 33/155 (21%)
ANK repeat 80..111 CDD:293786 10/63 (16%)
Ank_2 85..179 CDD:289560 26/126 (21%)
ANK repeat 113..146 CDD:293786 10/32 (31%)
ANK 143..268 CDD:238125 32/124 (26%)
ANK repeat 148..179 CDD:293786 7/30 (23%)
Ank_2 153..242 CDD:289560 23/88 (26%)
ANK repeat 181..212 CDD:293786 8/30 (27%)
ANK 209..334 CDD:238125 38/124 (31%)
ANK repeat 214..242 CDD:293786 10/27 (37%)
ANK repeat 247..278 CDD:293786 9/30 (30%)
Ank_2 252..344 CDD:289560 28/91 (31%)
ANK repeat 280..311 CDD:293786 9/30 (30%)
ANK repeat 313..344 CDD:293786 11/30 (37%)
DD 402..474 CDD:301326
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.