| Sequence 1: | NP_001162819.1 | Gene: | Ank / 43770 | FlyBaseID: | FBgn0011747 | Length: | 1549 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001070616.1 | Gene: | asb10 / 559467 | ZFINID: | ZDB-GENE-060929-1106 | Length: | 457 | Species: | Danio rerio |
| Alignment Length: | 283 | Identity: | 86/283 - (30%) |
|---|---|---|---|
| Similarity: | 125/283 - (44%) | Gaps: | 65/283 - (22%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 430 ESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLR-SAKVDAI 493
Fly 494 AREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKY-SALHIAAKEGQENIVQVLLENGAENN 557
Fly 558 AVTKKGFTPLHLAC----------KYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIV 612
Fly 613 ELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNV-- 675
Fly 676 -----------DMVQLLLEYGVI 687 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Ank | NP_001162819.1 | ANK | 67..192 | CDD:238125 | |
| ANK repeat | 72..103 | CDD:293786 | |||
| Ank_2 | 77..167 | CDD:289560 | |||
| ANK repeat | 105..136 | CDD:293786 | |||
| ANK repeat | 138..169 | CDD:293786 | |||
| ANK | 204..320 | CDD:238125 | |||
| ANK repeat | 204..231 | CDD:293786 | |||
| Ank_2 | 205..295 | CDD:289560 | |||
| ANK repeat | 233..264 | CDD:293786 | |||
| ANK repeat | 266..295 | CDD:293786 | |||
| ANK | 294..419 | CDD:238125 | |||
| ANK repeat | 299..330 | CDD:293786 | |||
| Ank_4 | 300..353 | CDD:290365 | |||
| ANK repeat | 332..363 | CDD:293786 | |||
| Ank_2 | 337..428 | CDD:289560 | |||
| ANK | 360..485 | CDD:238125 | 19/54 (35%) | ||
| ANK repeat | 365..395 | CDD:293786 | |||
| ANK repeat | 398..427 | CDD:293786 | |||
| ANK repeat | 431..462 | CDD:293786 | 10/30 (33%) | ||
| Ank_2 | 436..526 | CDD:289560 | 33/90 (37%) | ||
| ANK repeat | 464..494 | CDD:293786 | 12/30 (40%) | ||
| ANK | 491..616 | CDD:238125 | 45/135 (33%) | ||
| ANK repeat | 496..527 | CDD:293786 | 12/30 (40%) | ||
| Ank_2 | 501..592 | CDD:289560 | 33/101 (33%) | ||
| ANK repeat | 529..560 | CDD:293786 | 11/31 (35%) | ||
| ANK | 557..682 | CDD:238125 | 34/147 (23%) | ||
| ANK repeat | 562..590 | CDD:293786 | 10/37 (27%) | ||
| Ank_5 | 582..636 | CDD:290568 | 15/53 (28%) | ||
| ANK repeat | 595..625 | CDD:293786 | 11/29 (38%) | ||
| ANK repeat | 628..657 | CDD:293786 | 3/28 (11%) | ||
| Ank_2 | 633..723 | CDD:289560 | 16/68 (24%) | ||
| ANK repeat | 661..691 | CDD:293786 | 12/40 (30%) | ||
| ANK | 692..812 | CDD:238125 | |||
| ANK repeat | 693..724 | CDD:293786 | |||
| Ank_2 | 698..788 | CDD:289560 | |||
| ANK repeat | 726..755 | CDD:293786 | |||
| ANK repeat | 759..788 | CDD:293786 | |||
| ZU5 | 930..1034 | CDD:128514 | |||
| Death_ank | 1439..1521 | CDD:260029 | |||
| asb10 | NP_001070616.1 | ANK repeat | 108..138 | CDD:293786 | 10/30 (33%) |
| Ank_4 | 110..161 | CDD:290365 | 19/51 (37%) | ||
| ANK | <111..194 | CDD:238125 | 29/83 (35%) | ||
| ANK repeat | 141..171 | CDD:293786 | 12/29 (41%) | ||
| Ank_2 | 145..238 | CDD:289560 | 35/92 (38%) | ||
| ANK | 168..302 | CDD:238125 | 45/135 (33%) | ||
| ANK repeat | 173..204 | CDD:293786 | 12/30 (40%) | ||
| ANK repeat | 207..238 | CDD:293786 | 10/30 (33%) | ||
| Ank_2 | 212..306 | CDD:289560 | 32/95 (34%) | ||
| ANK repeat | 240..279 | CDD:293786 | 11/40 (28%) | ||
| ANK | 277..>347 | CDD:238125 | 24/106 (23%) | ||
| ANK repeat | 281..306 | CDD:293786 | 11/24 (46%) | ||
| Ank_2 | 286..384 | CDD:289560 | 26/101 (26%) | ||
| ANK repeat | 316..347 | CDD:293786 | 9/36 (25%) | ||
| SOCS | 411..457 | CDD:295349 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||