DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ank and Asb15

DIOPT Version :10

Sequence 1:NP_787122.1 Gene:Ank / 43770 FlyBaseID:FBgn0011747 Length:1549 Species:Drosophila melanogaster
Sequence 2:XP_038964544.1 Gene:Asb15 / 500050 RGDID:727860 Length:611 Species:Rattus norvegicus


Alignment Length:384 Identity:110/384 - (28%)
Similarity:185/384 - (48%) Gaps:36/384 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 EISDINSCNANGLNALHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLI 126
            ::||.|       ..|..|.:.|::....|.:.....::.|.:||...||.|.:.....::..::
  Rat    67 QLSDQN-------RKLVEAIRQGHIFELQEYVLHKYALEEADEKGWFPLHEAVVQPIQQILETVL 124

  Fly   127 --LYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVA 189
              .|......::.:|.|||.:|.:.......:|||..|..|:...:.|.|||.:|::||...||:
  Rat   125 DASYKTLWEFKTCDGETPLTLAIKAGLVENVKTLLEKGVWPNTKNDKGETPLLIAIKQGSYDIVS 189

  Fly   190 VLLENDVRGK----VRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGF--TPLHIAAHYGNVD 248
            .|::.:...:    .|..|:|.|||:...:...|||.|  ..|:..:.||  |||.:||.||:.|
  Rat   190 ALIKYNTSLEQPCVKRWSAMHEAAKQGRKDIITLLLNH--RGDVHLRDGFGVTPLGVAAEYGHCD 252

  Fly   249 IATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHV 313
            :...|::...||..:|....:.|..|...|.....:|||..|...:...|.|..|:|.|:..||.
  Rat   253 VLEHLIHKGGDVFALADDGASVLFEAAGGGNPDCISLLLKYGGSGNVPNRAGHLPIHRAAYEGHY 317

  Fly   314 EVIKHLLQQNAPILTK---TKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYL-------- 367
            ..:|:|:    |:.:|   .|:||:.:|.||.|::.:...||::|...|:.:..|::        
  Rat   318 LALKYLI----PVTSKHAIEKSGLTPIHSAADGQNAQCLELLIENGFDVNALLADHISQSYDDER 378

  Fly   368 -TALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANI 425
             |||:.|.....:...::||...|:||...||   .|.:|.:.||.::|.||:.:|||:
  Rat   379 KTALYFAVSNNDIHCTEVLLAAGADPNLDPLN---CLLVAVRANRHEIVRLLLSYGANV 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AnkNP_787122.1 ANKYR 20..337 CDD:440430 80/285 (28%)
ANK repeat 72..103 CDD:293786 4/30 (13%)
ANK repeat 105..136 CDD:293786 6/32 (19%)
ANK repeat 138..169 CDD:293786 10/30 (33%)
ANK repeat 204..231 CDD:293786 10/26 (38%)
ANKYR 217..502 CDD:440430 70/223 (31%)
ANK repeat 233..264 CDD:293786 13/32 (41%)
ANK repeat 266..295 CDD:293786 7/28 (25%)
ANK repeat 299..330 CDD:293786 10/33 (30%)
ANK repeat 332..363 CDD:293786 10/30 (33%)
ANK repeat 365..395 CDD:293786 10/38 (26%)
ANK repeat 398..427 CDD:293786 11/28 (39%)
ANK repeat 431..462 CDD:293786
ANK repeat 464..494 CDD:293786
ANK repeat 496..527 CDD:293786
ANKYR 510..797 CDD:440430
ANK repeat 529..560 CDD:293786
ANK repeat 562..590 CDD:293786
ANK repeat 595..625 CDD:293786
ANK repeat 628..657 CDD:293786
ANK repeat 661..691 CDD:293786
ANK repeat 693..724 CDD:293786
ANK repeat 726..755 CDD:293786
ANK repeat 759..788 CDD:293786
ZU5 930..1034 CDD:128514
UPA_2 1250..1378 CDD:375346
Death_ank 1439..1521 CDD:260029
Asb15XP_038964544.1 ANKYR 67..324 CDD:440430 74/265 (28%)
ANK repeat 104..136 CDD:293786 5/31 (16%)
ANK repeat 138..169 CDD:293786 10/30 (33%)
ANK repeat 172..202 CDD:293786 10/29 (34%)
ANKYR 206..466 CDD:440430 75/238 (32%)
ANK repeat 206..235 CDD:293786 10/30 (33%)
ANK repeat 237..268 CDD:293786 12/30 (40%)
ANK repeat 270..301 CDD:293786 7/30 (23%)
ANK repeat 335..375 CDD:293786 11/39 (28%)
ANK repeat 377..407 CDD:293786 9/29 (31%)
ANK repeat 409..435 CDD:293786 12/29 (41%)
ANK repeat 441..467 CDD:293786
SOCS 560..611 CDD:470605
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.