| Sequence 1: | NP_001162819.1 | Gene: | Ank / 43770 | FlyBaseID: | FBgn0011747 | Length: | 1549 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_009298394.1 | Gene: | asb13a.1 / 436801 | ZFINID: | ZDB-GENE-040718-261 | Length: | 311 | Species: | Danio rerio |
| Alignment Length: | 319 | Identity: | 94/319 - (29%) |
|---|---|---|---|
| Similarity: | 141/319 - (44%) | Gaps: | 59/319 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 498 QTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKK 562
Fly 563 GFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSP--NLC 625
Fly 626 ARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVISAA 690
Fly 691 AKNGL-TPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIE 754
Fly 755 MSSNIGYTPLHQAAQQGHIMIINL-LLRHKANPNAL---------TKDGNTALHIASNL 803 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Ank | NP_001162819.1 | ANK | 67..192 | CDD:238125 | |
| ANK repeat | 72..103 | CDD:293786 | |||
| Ank_2 | 77..167 | CDD:289560 | |||
| ANK repeat | 105..136 | CDD:293786 | |||
| ANK repeat | 138..169 | CDD:293786 | |||
| ANK | 204..320 | CDD:238125 | |||
| ANK repeat | 204..231 | CDD:293786 | |||
| Ank_2 | 205..295 | CDD:289560 | |||
| ANK repeat | 233..264 | CDD:293786 | |||
| ANK repeat | 266..295 | CDD:293786 | |||
| ANK | 294..419 | CDD:238125 | |||
| ANK repeat | 299..330 | CDD:293786 | |||
| Ank_4 | 300..353 | CDD:290365 | |||
| ANK repeat | 332..363 | CDD:293786 | |||
| Ank_2 | 337..428 | CDD:289560 | |||
| ANK | 360..485 | CDD:238125 | |||
| ANK repeat | 365..395 | CDD:293786 | |||
| ANK repeat | 398..427 | CDD:293786 | |||
| ANK repeat | 431..462 | CDD:293786 | |||
| Ank_2 | 436..526 | CDD:289560 | 10/27 (37%) | ||
| ANK repeat | 464..494 | CDD:293786 | |||
| ANK | 491..616 | CDD:238125 | 39/117 (33%) | ||
| ANK repeat | 496..527 | CDD:293786 | 10/28 (36%) | ||
| Ank_2 | 501..592 | CDD:289560 | 33/90 (37%) | ||
| ANK repeat | 529..560 | CDD:293786 | 11/30 (37%) | ||
| ANK | 557..682 | CDD:238125 | 35/126 (28%) | ||
| ANK repeat | 562..590 | CDD:293786 | 12/27 (44%) | ||
| Ank_5 | 582..636 | CDD:290568 | 13/55 (24%) | ||
| ANK repeat | 595..625 | CDD:293786 | 6/31 (19%) | ||
| ANK repeat | 628..657 | CDD:293786 | 4/28 (14%) | ||
| Ank_2 | 633..723 | CDD:289560 | 25/90 (28%) | ||
| ANK repeat | 661..691 | CDD:293786 | 10/29 (34%) | ||
| ANK | 692..812 | CDD:238125 | 35/123 (28%) | ||
| ANK repeat | 693..724 | CDD:293786 | 10/31 (32%) | ||
| Ank_2 | 698..788 | CDD:289560 | 28/90 (31%) | ||
| ANK repeat | 726..755 | CDD:293786 | 10/28 (36%) | ||
| ANK repeat | 759..788 | CDD:293786 | 7/29 (24%) | ||
| ZU5 | 930..1034 | CDD:128514 | |||
| Death_ank | 1439..1521 | CDD:260029 | |||
| asb13a.1 | XP_009298394.1 | ANK repeat | 20..49 | CDD:293786 | 10/28 (36%) |
| Ank_2 | 24..112 | CDD:289560 | 33/105 (31%) | ||
| ANK | 46..197 | CDD:238125 | 56/192 (29%) | ||
| ANK repeat | 51..82 | CDD:293786 | 11/30 (37%) | ||
| ANK repeat | 84..112 | CDD:293786 | 12/45 (27%) | ||
| ANK | 151..248 | CDD:238125 | 34/99 (34%) | ||
| Ank_2 | 151..239 | CDD:289560 | 31/90 (34%) | ||
| ANK repeat | 176..206 | CDD:293786 | 10/30 (33%) | ||
| ANK repeat | 208..239 | CDD:293786 | 10/30 (33%) | ||
| SOCS_ASB13 | 264..305 | CDD:239699 | 7/29 (24%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.910 | |||||