DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ank and Asb3

DIOPT Version :9

Sequence 1:NP_001162819.1 Gene:Ank / 43770 FlyBaseID:FBgn0011747 Length:1549 Species:Drosophila melanogaster
Sequence 2:XP_038948182.1 Gene:Asb3 / 364227 RGDID:1308462 Length:536 Species:Rattus norvegicus


Alignment Length:434 Identity:116/434 - (26%)
Similarity:194/434 - (44%) Gaps:90/434 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 IATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHV 313
            ::||:  .|.|.........:.:.:|.:.|.:.:...||.:|..:|.|...|..|:|.|:....|
  Rat     5 VSTLI--KKMDFTEAYSDTCSTVGLAAREGNVKILRKLLKKGRSVDVADNRGWMPIHEAAYHNAV 67

  Fly   314 EVIKHLLQQNAP---ILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAH 375
            |.::.|:..::.   |.|||..|..|||:|...                                
  Rat    68 ECLQMLIHTDSSENYIKTKTFEGFCALHLAVSQ-------------------------------- 100

  Fly   376 CGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANI-GATTESGLTPLHVA 439
             ||.||.::||:..|:||...|...|||.:|.:..:|.:::||::||||: |:.:..|...||.|
  Rat   101 -GHWKVTQILLEAGADPNTTTLEETTPLFLAVESGQIDVLKLLLQHGANVNGSHSMCGWNSLHQA 164

  Fly   440 SFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRSAKVDAIARE--GQTPLH 502
            ||.|                                 .|:.|::||:.. .|...::  |.|||.
  Rat   165 SFQG---------------------------------NAEAIKLLLKQG-ADRECQDDFGITPLF 195

  Fly   503 VASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKG--FT 565
            ||::.|.:..:.:|:..||.:|.|:.||.:.|.|||:||....|::||.|||:.:....:.  ..
  Rat   196 VAAQYGKLESLSILISSGANVNCQALDKATPLFIAAQEGHTKCVELLLSNGADPDLYCNEDNWQL 260

  Fly   566 PLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPN--LCARN 628
            |:|.|.:.|.:..:.:|:.........|.:.|:|::.|........:|.||:||.||:  :|...
  Rat   261 PIHAAAQMGHRKTLDLLIPLTNRACDSGPDKVSPVYSAVFGGREECLETLLQNGYSPDAQMCLVF 325

  Fly   629 G-QCAIHIACKKN--YLEIAMQLLQHGADVNIISKSGFSPLHLA 669
            | ...:.:|.:|:  :..:...||::||.:|        .||||
  Rat   326 GFSSPLCMALQKDCEFSGVVNILLKYGAQLN--------ELHLA 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AnkNP_001162819.1 ANK 67..192 CDD:238125
ANK repeat 72..103 CDD:293786
Ank_2 77..167 CDD:289560
ANK repeat 105..136 CDD:293786
ANK repeat 138..169 CDD:293786
ANK 204..320 CDD:238125 17/70 (24%)
ANK repeat 204..231 CDD:293786
Ank_2 205..295 CDD:289560 9/45 (20%)
ANK repeat 233..264 CDD:293786 4/14 (29%)
ANK repeat 266..295 CDD:293786 5/28 (18%)
ANK 294..419 CDD:238125 34/127 (27%)
ANK repeat 299..330 CDD:293786 9/33 (27%)
Ank_4 300..353 CDD:290365 16/55 (29%)
ANK repeat 332..363 CDD:293786 5/30 (17%)
Ank_2 337..428 CDD:289560 25/91 (27%)
ANK 360..485 CDD:238125 31/125 (25%)
ANK repeat 365..395 CDD:293786 9/29 (31%)
ANK repeat 398..427 CDD:293786 11/29 (38%)
ANK repeat 431..462 CDD:293786 7/30 (23%)
Ank_2 436..526 CDD:289560 22/91 (24%)
ANK repeat 464..494 CDD:293786 5/29 (17%)
ANK 491..616 CDD:238125 37/128 (29%)
ANK repeat 496..527 CDD:293786 11/32 (34%)
Ank_2 501..592 CDD:289560 28/92 (30%)
ANK repeat 529..560 CDD:293786 14/30 (47%)
ANK 557..682 CDD:238125 29/120 (24%)
ANK repeat 562..590 CDD:293786 5/29 (17%)
Ank_5 582..636 CDD:290568 14/56 (25%)
ANK repeat 595..625 CDD:293786 10/31 (32%)
ANK repeat 628..657 CDD:293786 7/31 (23%)
Ank_2 633..723 CDD:289560 11/39 (28%)
ANK repeat 661..691 CDD:293786 4/9 (44%)
ANK 692..812 CDD:238125
ANK repeat 693..724 CDD:293786
Ank_2 698..788 CDD:289560
ANK repeat 726..755 CDD:293786
ANK repeat 759..788 CDD:293786
ZU5 930..1034 CDD:128514
Death_ank 1439..1521 CDD:260029
Asb3XP_038948182.1 Ank_4 28..74 CDD:372654 13/45 (29%)
ANK repeat 53..87 CDD:293786 9/33 (27%)
PHA02874 63..>356 CDD:165205 96/359 (27%)
ANK repeat 89..120 CDD:293786 14/63 (22%)
ANK repeat 157..187 CDD:293786 12/63 (19%)
Ank_2 161..251 CDD:403870 37/123 (30%)
ANK repeat 189..220 CDD:293786 11/30 (37%)
ANK repeat 222..251 CDD:293786 14/28 (50%)
ANK repeat 256..290 CDD:293786 6/33 (18%)
ANK repeat 292..320 CDD:293786 10/27 (37%)
ANK repeat 325..357 CDD:293786 8/39 (21%)
SOCS_ASB3 469..519 CDD:239692
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24133
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.