DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ank and Ankdd1a

DIOPT Version :9

Sequence 1:NP_001162819.1 Gene:Ank / 43770 FlyBaseID:FBgn0011747 Length:1549 Species:Drosophila melanogaster
Sequence 2:NP_001357800.1 Gene:Ankdd1a / 330963 MGIID:2686319 Length:519 Species:Mus musculus


Alignment Length:391 Identity:108/391 - (27%)
Similarity:196/391 - (50%) Gaps:40/391 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 GLTP----LHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVD 360
            ||.|    ||.|||...||.:|.|.::...|..:...|..|||.||...|::|..|||:..|.||
Mouse    11 GLLPLERQLHEASRWNQVERMKELFEKRVNIRARNHVGRVALHWAAGAGHEQAVRLLLERGAAVD 75

  Fly   361 EVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANI 425
            :|....:.:|.::|..||:::                                 |::|:..||.:
Mouse    76 DVDSFGMNSLLLSAWFGHLQI---------------------------------VQILVNAGAKV 107

  Fly   426 GATTESGLTPLHVASFMGCINIVIYLLQ--HEASADLPTIRGETPLHLAARANQADIIRILLRSA 488
            ...::.|||.||.|:..|.:.::.::::  .:.:.|.....|.|..|.||...|.|.:..|:.|.
Mouse   108 HCESKDGLTLLHCAAQKGHVPVLAFVMEDLEDVALDHADKLGRTAFHRAAEHGQLDALDFLVGSG 172

  Fly   489 KVDAIA-REGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLEN 552
            ...::. :.|.|.||:|:..|:::::..|:..|.::..|:.:..:|||.||:....:.|.:||..
Mouse   173 CDHSVKDKGGNTALHLAASQGHVDVLQRLVDIGLDLEEQNTEGLTALHAAAEGIHADCVMLLLGA 237

  Fly   553 GAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLK 617
            |:..||:|:|..:.||.|...|.:::.:.|::.|...:...|...||:|:|..:|.|.:|:||:.
Mouse   238 GSNVNALTQKRLSCLHYAALGGSEDLSRALIKAGGCTNVADKQGTTPMHLAVKHNFPGLVQLLID 302

  Fly   618 NGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLL 682
            ..|..:......|..:|:|.:..:.::|..||..|||:::..|.|.:.|.:||:..:|.:|.:::
Mouse   303 GHSDLDAVDIRRQTPLHLAAEHAWQDVADMLLIAGADLSLRDKQGKTALAVAARSNHVSLVDMII 367

  Fly   683 E 683
            :
Mouse   368 K 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AnkNP_001162819.1 ANK 67..192 CDD:238125
ANK repeat 72..103 CDD:293786
Ank_2 77..167 CDD:289560
ANK repeat 105..136 CDD:293786
ANK repeat 138..169 CDD:293786
ANK 204..320 CDD:238125 11/23 (48%)
ANK repeat 204..231 CDD:293786
Ank_2 205..295 CDD:289560
ANK repeat 233..264 CDD:293786
ANK repeat 266..295 CDD:293786
ANK 294..419 CDD:238125 33/122 (27%)
ANK repeat 299..330 CDD:293786 13/33 (39%)
Ank_4 300..353 CDD:290365 22/56 (39%)
ANK repeat 332..363 CDD:293786 14/30 (47%)
Ank_2 337..428 CDD:289560 21/90 (23%)
ANK 360..485 CDD:238125 25/126 (20%)
ANK repeat 365..395 CDD:293786 4/29 (14%)
ANK repeat 398..427 CDD:293786 4/28 (14%)
ANK repeat 431..462 CDD:293786 8/32 (25%)
Ank_2 436..526 CDD:289560 22/92 (24%)
ANK repeat 464..494 CDD:293786 9/29 (31%)
ANK 491..616 CDD:238125 37/125 (30%)
ANK repeat 496..527 CDD:293786 8/30 (27%)
Ank_2 501..592 CDD:289560 26/90 (29%)
ANK repeat 529..560 CDD:293786 11/30 (37%)
ANK 557..682 CDD:238125 37/124 (30%)
ANK repeat 562..590 CDD:293786 7/27 (26%)
Ank_5 582..636 CDD:290568 15/53 (28%)
ANK repeat 595..625 CDD:293786 10/29 (34%)
ANK repeat 628..657 CDD:293786 9/28 (32%)
Ank_2 633..723 CDD:289560 15/51 (29%)
ANK repeat 661..691 CDD:293786 6/23 (26%)
ANK 692..812 CDD:238125
ANK repeat 693..724 CDD:293786
Ank_2 698..788 CDD:289560
ANK repeat 726..755 CDD:293786
ANK repeat 759..788 CDD:293786
ZU5 930..1034 CDD:128514
Death_ank 1439..1521 CDD:260029
Ankdd1aNP_001357800.1 Ank_2 19..108 CDD:372319 33/121 (27%)
ANK repeat 19..45 CDD:293786 10/25 (40%)
ANK repeat 47..78 CDD:293786 14/30 (47%)
ANK repeat 80..110 CDD:293786 8/62 (13%)
PHA03095 96..>368 CDD:222980 76/304 (25%)
ANK repeat 113..146 CDD:293786 8/32 (25%)
ANK repeat 149..179 CDD:293786 9/29 (31%)
ANK repeat 181..212 CDD:293786 8/30 (27%)
ANK repeat 214..243 CDD:293786 9/28 (32%)
ANK repeat 250..278 CDD:293786 6/27 (22%)
ANK repeat 280..311 CDD:293786 10/30 (33%)
ANK repeat 313..344 CDD:293786 9/30 (30%)
DD 420..491 CDD:387368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.