Sequence 1: | NP_001162819.1 | Gene: | Ank / 43770 | FlyBaseID: | FBgn0011747 | Length: | 1549 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001101059.1 | Gene: | Ankrd2 / 309374 | RGDID: | 1305104 | Length: | 328 | Species: | Rattus norvegicus |
Alignment Length: | 248 | Identity: | 78/248 - (31%) |
---|---|---|---|
Similarity: | 108/248 - (43%) | Gaps: | 41/248 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 486 RSAKVDAIAREGQTP---------------LHVASRLGNINIIMLLLQHGAEINAQSNDKYSALH 535
Fly 536 IAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPL 600
Fly 601 HVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSP 665
Fly 666 LHLAAQGGNVDMVQL-------LLEYGVISAAAKNGL--------TPLHVAAQ 703 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ank | NP_001162819.1 | ANK | 67..192 | CDD:238125 | |
ANK repeat | 72..103 | CDD:293786 | |||
Ank_2 | 77..167 | CDD:289560 | |||
ANK repeat | 105..136 | CDD:293786 | |||
ANK repeat | 138..169 | CDD:293786 | |||
ANK | 204..320 | CDD:238125 | |||
ANK repeat | 204..231 | CDD:293786 | |||
Ank_2 | 205..295 | CDD:289560 | |||
ANK repeat | 233..264 | CDD:293786 | |||
ANK repeat | 266..295 | CDD:293786 | |||
ANK | 294..419 | CDD:238125 | |||
ANK repeat | 299..330 | CDD:293786 | |||
Ank_4 | 300..353 | CDD:290365 | |||
ANK repeat | 332..363 | CDD:293786 | |||
Ank_2 | 337..428 | CDD:289560 | |||
ANK | 360..485 | CDD:238125 | |||
ANK repeat | 365..395 | CDD:293786 | |||
ANK repeat | 398..427 | CDD:293786 | |||
ANK repeat | 431..462 | CDD:293786 | |||
Ank_2 | 436..526 | CDD:289560 | 12/54 (22%) | ||
ANK repeat | 464..494 | CDD:293786 | 3/7 (43%) | ||
ANK | 491..616 | CDD:238125 | 45/139 (32%) | ||
ANK repeat | 496..527 | CDD:293786 | 8/45 (18%) | ||
Ank_2 | 501..592 | CDD:289560 | 31/90 (34%) | ||
ANK repeat | 529..560 | CDD:293786 | 13/30 (43%) | ||
ANK | 557..682 | CDD:238125 | 43/131 (33%) | ||
ANK repeat | 562..590 | CDD:293786 | 10/27 (37%) | ||
Ank_5 | 582..636 | CDD:290568 | 21/53 (40%) | ||
ANK repeat | 595..625 | CDD:293786 | 12/29 (41%) | ||
ANK repeat | 628..657 | CDD:293786 | 12/28 (43%) | ||
Ank_2 | 633..723 | CDD:289560 | 26/86 (30%) | ||
ANK repeat | 661..691 | CDD:293786 | 8/36 (22%) | ||
ANK | 692..812 | CDD:238125 | 8/20 (40%) | ||
ANK repeat | 693..724 | CDD:293786 | 8/19 (42%) | ||
Ank_2 | 698..788 | CDD:289560 | 3/6 (50%) | ||
ANK repeat | 726..755 | CDD:293786 | |||
ANK repeat | 759..788 | CDD:293786 | |||
ZU5 | 930..1034 | CDD:128514 | |||
Death_ank | 1439..1521 | CDD:260029 | |||
Ankrd2 | NP_001101059.1 | Ank_4 | 120..170 | CDD:290365 | 14/50 (28%) |
ANK | 144..269 | CDD:238125 | 44/124 (35%) | ||
ANK repeat | 151..180 | CDD:293786 | 13/28 (46%) | ||
Ank_2 | 154..246 | CDD:289560 | 36/91 (40%) | ||
ANK repeat | 184..213 | CDD:293786 | 11/28 (39%) | ||
ANK repeat | 215..246 | CDD:293786 | 12/30 (40%) | ||
Ank_5 | 231..289 | CDD:290568 | 22/66 (33%) | ||
ANK repeat | 248..279 | CDD:293786 | 12/30 (40%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |