DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ank and Ankrd2

DIOPT Version :9

Sequence 1:NP_001162819.1 Gene:Ank / 43770 FlyBaseID:FBgn0011747 Length:1549 Species:Drosophila melanogaster
Sequence 2:NP_001101059.1 Gene:Ankrd2 / 309374 RGDID:1305104 Length:328 Species:Rattus norvegicus


Alignment Length:248 Identity:78/248 - (31%)
Similarity:108/248 - (43%) Gaps:41/248 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   486 RSAKVDAIAREGQTP---------------LHVASRLGNINIIMLLLQHGAEINAQSNDKYSALH 535
            :..|.||:|...:.|               |..|.. |.|.:|...|..|...:.....:.:|||
  Rat    92 KQKKRDALAAAQEPPPEPEEITGPVDEETFLKAAVE-GKIKVIDKYLADGGSADTCDEFRRTALH 155

  Fly   536 IAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPL 600
            .|:.||...|::.||||||..:...:...|.:|.||:.|...||::|...||:.|.:.|...|||
  Rat   156 RASLEGHMEILEKLLENGATVDFQDRLDCTAMHWACRGGHLEVVKLLQSRGANTDVRDKLLSTPL 220

  Fly   601 HVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSP 665
            |||....:..|||..|..|...|...|.|..|:|.|.:.|..:|...||.||||:...:.:|.:|
  Rat   221 HVAVRTGHVEIVEHFLSLGLDINAKDREGDSALHDAVRLNRYKIIKLLLLHGADMMAKNMAGKTP 285

  Fly   666 LHLAAQGGNVDMVQL-------LLEYGVISAAAKNGL--------TPLHVAAQ 703
                     .|:|||       .||:.. ..:.:|||        ||..|.||
  Rat   286 ---------TDLVQLWQADTRHALEHPE-PESEQNGLERPGSGRETPQPVPAQ 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AnkNP_001162819.1 ANK 67..192 CDD:238125
ANK repeat 72..103 CDD:293786
Ank_2 77..167 CDD:289560
ANK repeat 105..136 CDD:293786
ANK repeat 138..169 CDD:293786
ANK 204..320 CDD:238125
ANK repeat 204..231 CDD:293786
Ank_2 205..295 CDD:289560
ANK repeat 233..264 CDD:293786
ANK repeat 266..295 CDD:293786
ANK 294..419 CDD:238125
ANK repeat 299..330 CDD:293786
Ank_4 300..353 CDD:290365
ANK repeat 332..363 CDD:293786
Ank_2 337..428 CDD:289560
ANK 360..485 CDD:238125
ANK repeat 365..395 CDD:293786
ANK repeat 398..427 CDD:293786
ANK repeat 431..462 CDD:293786
Ank_2 436..526 CDD:289560 12/54 (22%)
ANK repeat 464..494 CDD:293786 3/7 (43%)
ANK 491..616 CDD:238125 45/139 (32%)
ANK repeat 496..527 CDD:293786 8/45 (18%)
Ank_2 501..592 CDD:289560 31/90 (34%)
ANK repeat 529..560 CDD:293786 13/30 (43%)
ANK 557..682 CDD:238125 43/131 (33%)
ANK repeat 562..590 CDD:293786 10/27 (37%)
Ank_5 582..636 CDD:290568 21/53 (40%)
ANK repeat 595..625 CDD:293786 12/29 (41%)
ANK repeat 628..657 CDD:293786 12/28 (43%)
Ank_2 633..723 CDD:289560 26/86 (30%)
ANK repeat 661..691 CDD:293786 8/36 (22%)
ANK 692..812 CDD:238125 8/20 (40%)
ANK repeat 693..724 CDD:293786 8/19 (42%)
Ank_2 698..788 CDD:289560 3/6 (50%)
ANK repeat 726..755 CDD:293786
ANK repeat 759..788 CDD:293786
ZU5 930..1034 CDD:128514
Death_ank 1439..1521 CDD:260029
Ankrd2NP_001101059.1 Ank_4 120..170 CDD:290365 14/50 (28%)
ANK 144..269 CDD:238125 44/124 (35%)
ANK repeat 151..180 CDD:293786 13/28 (46%)
Ank_2 154..246 CDD:289560 36/91 (40%)
ANK repeat 184..213 CDD:293786 11/28 (39%)
ANK repeat 215..246 CDD:293786 12/30 (40%)
Ank_5 231..289 CDD:290568 22/66 (33%)
ANK repeat 248..279 CDD:293786 12/30 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.