DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Ank and SPAC105.02c

DIOPT Version :9

Sequence 1:	NP_001162819.1	Gene:	Ank / 43770	FlyBaseID:	FBgn0011747	Length:	1549	Species:	Drosophila melanogaster
Sequence 2:	NP_593466.1	Gene:	SPAC105.02c / 2542971	PomBaseID:	SPAC105.02c	Length:	170	Species:	Schizosaccharomyces pombe

Alignment Length:	157	Identity:	43/157 - (27%)
Similarity:	67/157 - (42%)	Gaps:	31/157 - (19%)

- Green bases have known domain annotations that are detailed below.

  Fly    66 INSCNANGLNAL----HLAAKDGYVDICCELLRRGIKIDNATKK-GNTALHIASLAGQHDVINQL 125
            |.:|.:|.::.|    |....|| |..          |:||... ||..:|:.:..|..:.::.|
pombe    13 IAACRSNNVDMLEEVVHQQEGDG-VSF----------INNARDSLGNDCVHVCTKYGSLECLDWL 66

  Fly   126 I-LYNANVNVQ-SLNGFTPLYMAA------QENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQ 182
            : :...|:|.: .:.|.|||:.|.      ||........|:..||:|.|:..|||.|:.:....
pombe    67 LDISGVNLNNRCRMTGDTPLHFAVMFIKKDQETALRMVEMLMEVGADPLLTNNDGFRPIDLVPGD 131

  Fly   183 GHDKIVAVLLENDVRGKVRLPALHIAA 209
            .|| :.|..||...      |||..:|
pombe   132 FHD-VFASALEGPA------PALQYSA 151

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Ank	NP_001162819.1	ANK	67..192	CDD:238125	36/137 (26%)
		ANK repeat	72..103	CDD:293786	8/34 (24%)
		Ank_2	77..167	CDD:289560	26/102 (25%)
		ANK repeat	105..136	CDD:293786	7/33 (21%)
		ANK repeat	138..169	CDD:293786	12/36 (33%)
		ANK	204..320	CDD:238125	3/6 (50%)
		ANK repeat	204..231	CDD:293786	3/6 (50%)
		Ank_2	205..295	CDD:289560	2/5 (40%)
		ANK repeat	233..264	CDD:293786
		ANK repeat	266..295	CDD:293786
		ANK	294..419	CDD:238125
		ANK repeat	299..330	CDD:293786
		Ank_4	300..353	CDD:290365
		ANK repeat	332..363	CDD:293786
		Ank_2	337..428	CDD:289560
		ANK	360..485	CDD:238125
		ANK repeat	365..395	CDD:293786
		ANK repeat	398..427	CDD:293786
		ANK repeat	431..462	CDD:293786
		Ank_2	436..526	CDD:289560
		ANK repeat	464..494	CDD:293786
		ANK	491..616	CDD:238125
		ANK repeat	496..527	CDD:293786
		Ank_2	501..592	CDD:289560
		ANK repeat	529..560	CDD:293786
		ANK	557..682	CDD:238125
		ANK repeat	562..590	CDD:293786
		Ank_5	582..636	CDD:290568
		ANK repeat	595..625	CDD:293786
		ANK repeat	628..657	CDD:293786
		Ank_2	633..723	CDD:289560
		ANK repeat	661..691	CDD:293786
		ANK	692..812	CDD:238125
		ANK repeat	693..724	CDD:293786
		Ank_2	698..788	CDD:289560
		ANK repeat	726..755	CDD:293786
		ANK repeat	759..788	CDD:293786
		ZU5	930..1034	CDD:128514
		Death_ank	1439..1521	CDD:260029
SPAC105.02c	NP_593466.1	ANK	12..127	CDD:238125	34/124 (27%)
		Ank_2	12..118	CDD:289560	30/115 (26%)
		ANK repeat	12..44	CDD:293786	11/41 (27%)
		ANK repeat	46..79	CDD:293786	7/32 (22%)
		ANK repeat	81..118	CDD:293786	12/36 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910