DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ank and Ankrd65

DIOPT Version :9

Sequence 1:NP_001162819.1 Gene:Ank / 43770 FlyBaseID:FBgn0011747 Length:1549 Species:Drosophila melanogaster
Sequence 2:NP_001357751.1 Gene:Ankrd65 / 242805 MGIID:2685285 Length:364 Species:Mus musculus


Alignment Length:459 Identity:117/459 - (25%)
Similarity:186/459 - (40%) Gaps:139/459 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 LHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLS 335
            |..|..||..||...||.:|:.::.....|.||||.|...||..:::.|||:.|           
Mouse    37 LFQAVWWGAPSLVMQLLRQGSSVEERDHTGRTPLHLAVMRGHAPLVRLLLQRGA----------- 90

  Fly   336 ALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGF 400
               :|...:|...                   |.||.||..||..||                  
Mouse    91 ---LAGAPDHTGR-------------------TPLHEAAWHGHSNVA------------------ 115

  Fly   401 TPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMG-CINIVIYLLQHEASADLPTIR 464
                           |||::.||:..|.:::||||||.|:.:| .:.:..:.:..::.:|:..:|
Mouse   116 ---------------ELLLRRGASAAACSQTGLTPLHGAAALGRTLLVTSFTVASDSGSDVKDVR 165

  Fly   465 GETPLHLAARANQADIIRILLRSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSND 529
            |.|..|.||...|..::.:|......|.   :|  .|.|::..|:.:.:.|||..||:::.|.:.
Mouse   166 GWTAAHWAAACGQLAVLELLSAGGNADL---DG--ALLVSAIAGSTSSLQLLLTLGAKVDTQDST 225

  Fly   530 KYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGK 594
            ..:||.:||..|....::|||::||:                                       
Mouse   226 GATALGLAAGLGHHQDIEVLLDHGAD--------------------------------------- 251

  Fly   595 NDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIIS 659
                                       ||:..||.:.|:|.|....:|.:...|:..|.:::...
Mouse   252 ---------------------------PNIRDRNNRSALHRAATGGHLRVTQLLVAKGIEIDAQD 289

  Fly   660 KSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISER 723
            ..|.:|||.||:||:|::|..||:.|. |:||.....||||:|.:.||....::||..|||.:.|
Mouse   290 SLGLTPLHHAARGGHVEVVSHLLDRGAHINAAGWLHKTPLHLAVENGHSTTVELLLSRGANSTLR 354

  Fly   724 TRNG 727
            |:.|
Mouse   355 TQWG 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AnkNP_001162819.1 ANK 67..192 CDD:238125
ANK repeat 72..103 CDD:293786
Ank_2 77..167 CDD:289560
ANK repeat 105..136 CDD:293786
ANK repeat 138..169 CDD:293786
ANK 204..320 CDD:238125 17/48 (35%)
ANK repeat 204..231 CDD:293786
Ank_2 205..295 CDD:289560 9/23 (39%)
ANK repeat 233..264 CDD:293786
ANK repeat 266..295 CDD:293786 9/23 (39%)
ANK 294..419 CDD:238125 25/124 (20%)
ANK repeat 299..330 CDD:293786 12/30 (40%)
Ank_4 300..353 CDD:290365 14/52 (27%)
ANK repeat 332..363 CDD:293786 2/30 (7%)
Ank_2 337..428 CDD:289560 16/90 (18%)
ANK 360..485 CDD:238125 31/125 (25%)
ANK repeat 365..395 CDD:293786 9/29 (31%)
ANK repeat 398..427 CDD:293786 5/28 (18%)
ANK repeat 431..462 CDD:293786 9/31 (29%)
Ank_2 436..526 CDD:289560 23/90 (26%)
ANK repeat 464..494 CDD:293786 9/29 (31%)
ANK 491..616 CDD:238125 21/124 (17%)
ANK repeat 496..527 CDD:293786 9/30 (30%)
Ank_2 501..592 CDD:289560 19/90 (21%)
ANK repeat 529..560 CDD:293786 10/30 (33%)
ANK 557..682 CDD:238125 20/124 (16%)
ANK repeat 562..590 CDD:293786 0/27 (0%)
Ank_5 582..636 CDD:290568 6/53 (11%)
ANK repeat 595..625 CDD:293786 2/29 (7%)
ANK repeat 628..657 CDD:293786 7/28 (25%)
Ank_2 633..723 CDD:289560 33/90 (37%)
ANK repeat 661..691 CDD:293786 15/30 (50%)
ANK 692..812 CDD:238125 15/36 (42%)
ANK repeat 693..724 CDD:293786 12/30 (40%)
Ank_2 698..788 CDD:289560 13/30 (43%)
ANK repeat 726..755 CDD:293786 1/2 (50%)
ANK repeat 759..788 CDD:293786
ZU5 930..1034 CDD:128514
Death_ank 1439..1521 CDD:260029
Ankrd65NP_001357751.1 ANK repeat 33..63 CDD:293786 9/25 (36%)
PHA03095 49..>347 CDD:222980 105/434 (24%)
ANK repeat 65..96 CDD:293786 13/44 (30%)
ANK repeat 98..123 CDD:293786 12/76 (16%)
ANK repeat 165..223 CDD:293786 18/62 (29%)
ANK repeat 226..256 CDD:293786 12/95 (13%)
ANK repeat 258..289 CDD:293786 7/30 (23%)
ANK repeat 291..320 CDD:293786 14/28 (50%)
ANK repeat 324..354 CDD:293786 12/29 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.