DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ank and ASB7

DIOPT Version :10

Sequence 1:NP_787122.1 Gene:Ank / 43770 FlyBaseID:FBgn0011747 Length:1549 Species:Drosophila melanogaster
Sequence 2:NP_937886.1 Gene:ASB7 / 140460 HGNCID:17182 Length:318 Species:Homo sapiens


Alignment Length:366 Identity:90/366 - (24%)
Similarity:140/366 - (38%) Gaps:136/366 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   370 LHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLT 434
            :..|...|.|...:.:|:...:||.|..||:|.||.:..:.:.:.|.:.::|||:          
Human    18 IQAAVAAGDVHTVRKMLEQGYSPNGRDANGWTLLHFSAARGKERCVRVFLEHGAD---------- 72

  Fly   435 PLHVASFMGCINIVIYLLQHEASADLPTIR----GETPLHLAARANQADIIRILLRSAKVDAIAR 495
                                      ||::    |.|.||.||...:|.|.|::|.|.....|  
Human    73 --------------------------PTVKDLIGGFTALHYAAMHGRARIARLMLESEYRSDI-- 109

  Fly   496 EGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVT 560
                                       |||:|||.::.||:||..|:::.|::|||..||.:.::
Human   110 ---------------------------INAKSNDGWTPLHVAAHYGRDSFVRLLLEFKAEVDPLS 147

  Fly   561 KKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLC 625
            .||.|||.||....:.:.|:|||.:.|:||.|                                 
Human   148 DKGTTPLQLAIIRERSSCVKILLDHNANIDIQ--------------------------------- 179

  Fly   626 ARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVISAA 690
              ||....:...|.|:....| .||.|||.|:               |.::              
Human   180 --NGFLLRYAVIKSNHSYCRM-FLQRGADTNL---------------GRLE-------------- 212

  Fly   691 AKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPL 731
              :|.||||::|....||.:::|..:||:.:.|...|.|||
Human   213 --DGQTPLHLSALRDDVLCARMLYNYGADTNTRNYEGQTPL 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AnkNP_787122.1 ANKYR 20..337 CDD:440430
ANK repeat 72..103 CDD:293786
ANK repeat 105..136 CDD:293786
ANK repeat 138..169 CDD:293786
ANK repeat 204..231 CDD:293786
ANKYR 217..502 CDD:440430 30/135 (22%)
ANK repeat 233..264 CDD:293786
ANK repeat 266..295 CDD:293786
ANK repeat 299..330 CDD:293786
ANK repeat 332..363 CDD:293786
ANK repeat 365..395 CDD:293786 6/24 (25%)
ANK repeat 398..427 CDD:293786 9/28 (32%)
ANK repeat 431..462 CDD:293786 0/30 (0%)
ANK repeat 464..494 CDD:293786 11/33 (33%)
ANK repeat 496..527 CDD:293786 3/30 (10%)
ANKYR 510..797 CDD:440430 60/222 (27%)
ANK repeat 529..560 CDD:293786 12/30 (40%)
ANK repeat 562..590 CDD:293786 12/27 (44%)
ANK repeat 595..625 CDD:293786 0/29 (0%)
ANK repeat 628..657 CDD:293786 10/28 (36%)
ANK repeat 661..691 CDD:293786 1/29 (3%)
ANK repeat 693..724 CDD:293786 11/30 (37%)
ANK repeat 726..755 CDD:293786 4/6 (67%)
ANK repeat 759..788 CDD:293786
ZU5 930..1034 CDD:128514
UPA_2 1250..1378 CDD:375346
Death_ank 1439..1521 CDD:260029
ASB7NP_937886.1 ANK 1 13..42 5/23 (22%)
ANKYR 16..251 CDD:440430 88/364 (24%)
ANK repeat 46..77 CDD:293786 11/66 (17%)
ANK 2 46..75 10/64 (16%)
ANK 3 80..109 11/28 (39%)
ANK repeat 81..114 CDD:293786 15/61 (25%)
ANK repeat 116..147 CDD:293786 12/30 (40%)
ANK 4 116..145 12/28 (43%)
ANK repeat 149..180 CDD:293786 15/65 (23%)
ANK 5 149..178 13/28 (46%)
ANK 6 180..208 10/28 (36%)
ANK repeat 213..244 CDD:293786 11/30 (37%)
ANK 7 213..242 11/28 (39%)
SOCS_ASB7 273..317 CDD:239696
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.