DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ank and ankrd2

DIOPT Version :9

Sequence 1:NP_001162819.1 Gene:Ank / 43770 FlyBaseID:FBgn0011747 Length:1549 Species:Drosophila melanogaster
Sequence 2:XP_021336623.1 Gene:ankrd2 / 101886079 ZFINID:ZDB-GENE-090313-383 Length:303 Species:Danio rerio


Alignment Length:301 Identity:87/301 - (28%)
Similarity:132/301 - (43%) Gaps:48/301 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   473 ARANQADIIRILLRSAKVDAIAREGQTPLHVASRLGNINIIMLL--LQHGAEINAQSNDKYSALH 535
            |||.:..|:       .|||.| ||          ||:::...|  :|....:...|:|  ....
Zfish    26 ARARKLGIL-------VVDAGA-EG----------GNVSVNQSLADIQDEERVRKISSD--LRRE 70

  Fly   536 IAAKEGQENIVQVLLENGAENNAVT-KKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTP 599
            |....|.|||:::..:.....|..| .|..|.:..|.:      .:..|:..|    |||.:|  
Zfish    71 IVDLGGAENIIELCTQKKKIKNKTTLSKDITNVSGAVE------PEEFLKAAA----QGKMEV-- 123

  Fly   600 LHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFS 664
                        ||..|.:|..||.|....:.|:|.|..:|:.:|..:||..|||:|...:.|..
Zfish   124 ------------VERFLDDGGDPNTCDEFRKTALHRAALQNHTKIVEKLLDKGADINFKDRLGCR 176

  Fly   665 PLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGY 728
            .:|.|.:||::..:.:|.:.|. |:...|...:|||||.:.||..|.|.||:.|.||:.:...|.
Zfish   177 AVHWACRGGSLSALTVLQDRGADINVRDKLLSSPLHVATRTGHSDVVQHLLDSGININAKDWEGD 241

  Fly   729 TPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQ 769
            |.||.|..:....:||..|...||:::.:..|.|...|..|
Zfish   242 TVLHDAVRFNRYKIVKQLILAGADMQIKNAEGITATEQVKQ 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AnkNP_001162819.1 ANK 67..192 CDD:238125
ANK repeat 72..103 CDD:293786
Ank_2 77..167 CDD:289560
ANK repeat 105..136 CDD:293786
ANK repeat 138..169 CDD:293786
ANK 204..320 CDD:238125
ANK repeat 204..231 CDD:293786
Ank_2 205..295 CDD:289560
ANK repeat 233..264 CDD:293786
ANK repeat 266..295 CDD:293786
ANK 294..419 CDD:238125
ANK repeat 299..330 CDD:293786
Ank_4 300..353 CDD:290365
ANK repeat 332..363 CDD:293786
Ank_2 337..428 CDD:289560
ANK 360..485 CDD:238125 4/11 (36%)
ANK repeat 365..395 CDD:293786
ANK repeat 398..427 CDD:293786
ANK repeat 431..462 CDD:293786
Ank_2 436..526 CDD:289560 14/54 (26%)
ANK repeat 464..494 CDD:293786 7/20 (35%)
ANK 491..616 CDD:238125 29/127 (23%)
ANK repeat 496..527 CDD:293786 6/32 (19%)
Ank_2 501..592 CDD:289560 18/93 (19%)
ANK repeat 529..560 CDD:293786 7/30 (23%)
ANK 557..682 CDD:238125 34/125 (27%)
ANK repeat 562..590 CDD:293786 5/27 (19%)
Ank_5 582..636 CDD:290568 15/53 (28%)
ANK repeat 595..625 CDD:293786 7/29 (24%)
ANK repeat 628..657 CDD:293786 10/28 (36%)
Ank_2 633..723 CDD:289560 33/90 (37%)
ANK repeat 661..691 CDD:293786 8/30 (27%)
ANK 692..812 CDD:238125 29/78 (37%)
ANK repeat 693..724 CDD:293786 14/30 (47%)
Ank_2 698..788 CDD:289560 27/72 (38%)
ANK repeat 726..755 CDD:293786 10/28 (36%)
ANK repeat 759..788 CDD:293786 4/11 (36%)
ZU5 930..1034 CDD:128514
Death_ank 1439..1521 CDD:260029
ankrd2XP_021336623.1 ANK 135..260 CDD:238125 43/124 (35%)
ANK repeat 143..171 CDD:293786 11/27 (41%)
ANK repeat 174..204 CDD:293786 8/29 (28%)
ANK repeat 206..237 CDD:293786 14/30 (47%)
ANK repeat 239..270 CDD:293786 10/30 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.