DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pan and TCF7

DIOPT Version :9

Sequence 1:NP_726528.2 Gene:pan / 43769 FlyBaseID:FBgn0085432 Length:1192 Species:Drosophila melanogaster
Sequence 2:XP_006714741.1 Gene:TCF7 / 6932 HGNCID:11639 Length:460 Species:Homo sapiens


Alignment Length:156 Identity:102/156 - (65%)
Similarity:117/156 - (75%) Gaps:19/156 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   675 PYDLSIGSKTKHMNLEAKHTSNAQSNESKETTNDKKKPHIKKPLNAFMLYMKEMRAKVVAECTLK 739
            |:|.::  ||:           |:|...||.    |||.|||||||||||||||||||:||||||
Human   278 PFDRNL--KTQ-----------AESKAEKEA----KKPTIKKPLNAFMLYMKEMRAKVIAECTLK 325

  Fly   740 ESAAINQILGRRWHELSREEQSKYYEKARQERQLHMELYPGWSARDNYGYVSKKKKRKKDRSTTD 804
            ||||||||||||||.||||||:||||.||:||||||:||||||||||||...::.:.|...||||
Human   326 ESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQESTTD 390

  Fly   805 SGGNNMKKCRARFGLDQQSQWCKPCR 830
            .|  :.|||||||||:||:.||.|||
Human   391 PG--SPKKCRARFGLNQQTDWCGPCR 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
panNP_726528.2 SOX-TCF_HMG-box 713..784 CDD:238684 63/70 (90%)
TCF7XP_006714741.1 CTNNB1_binding 20..212 CDD:285538
SOX-TCF_HMG-box 300..370 CDD:238684 63/69 (91%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 134 1.000 Domainoid score I5013
eggNOG 1 0.900 - - E1_KOG3248
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000839
OrthoInspector 1 1.000 - - otm42264
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10373
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.