DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pan and NCCRP1

DIOPT Version :9

Sequence 1:NP_726528.2 Gene:pan / 43769 FlyBaseID:FBgn0085432 Length:1192 Species:Drosophila melanogaster
Sequence 2:NP_001001414.1 Gene:NCCRP1 / 342897 HGNCID:33739 Length:275 Species:Homo sapiens


Alignment Length:165 Identity:37/165 - (22%)
Similarity:55/165 - (33%) Gaps:55/165 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   866 EDDYDDDKLGGSCGSADETNKIEDEDSESLNQSMPSPGCLSGLSSLQSPSTTMS---LASPLNMN 927
            |:..:...|||.         :|.:...||.:..|||         :|||...|   |.||.::.
Human     2 EEVREGHALGGG---------MEADGPASLQELPPSP---------RSPSPPPSPPPLPSPPSLP 48

  Fly   928 ANSATNVIFPASSNALLIVGADQPT-AQQRPTLVSTSGSSSGSTS------------------SI 973
            :        ||:..|..:....||: |..|..|:...|..||...                  ::
Human    49 S--------PAAPEAPELPEPAQPSEAHARQLLLEEWGPLSGGLELPQRLTWKLLLLRRPLYRNL 105

  Fly   974 STTPNTS--STVSPVTCMTGPCLGSSQERAMMLGN 1006
            ..:||..  :...|     .|..|.:|.....|||
Human   106 LRSPNPEGINIYEP-----APPTGPTQRPLETLGN 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
panNP_726528.2 SOX-TCF_HMG-box 713..784 CDD:238684
NCCRP1NP_001001414.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..67 22/90 (24%)
FBA 128..271 CDD:309438 3/8 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3248
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.