DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pan and SPBC28F2.11

DIOPT Version :9

Sequence 1:NP_726528.2 Gene:pan / 43769 FlyBaseID:FBgn0085432 Length:1192 Species:Drosophila melanogaster
Sequence 2:NP_595672.1 Gene:SPBC28F2.11 / 2540337 PomBaseID:SPBC28F2.11 Length:310 Species:Schizosaccharomyces pombe


Alignment Length:216 Identity:44/216 - (20%)
Similarity:86/216 - (39%) Gaps:46/216 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   622 ENVSHLITKTLSSANASLTA-QELSITNLFKERLCALQGNAGSMKTEIFPMIDAP------YDLS 679
            |.:|...|:...:...:||| :|:      :|.|.::.|....:.....|.:..|      .:::
pombe     9 EKISGSFTRLAEAFQLALTACREI------EESLPSILGEKSEVSKPFKPAVTDPSNAKKEINMA 67

  Fly   680 IGSKTKHMNLEAKHT-----------------SNAQSNESKETTNDKKKPHIKKPLNAFMLYMKE 727
            |.|.:|......|.|                 :.|....:|....|..:|  |:|.:|:.|:.|.
pombe    68 IESPSKKATSPKKATPAAVAPVEATSAVDTSEAVASMTPNKRKARDPAQP--KRPPSAYNLFQKN 130

  Fly   728 MRAKVVAECTLKESAA--------INQILGRRWHELSREEQSKYYEKARQERQLHMELYPGWSAR 784
            .|:::      |||..        :|:.:..:|..||.:::..|.|:|.:.|:.:.|....::|.
pombe   131 QRSEI------KESLGEKSNDVKEVNKAMHEKWGSLSEDDRKTYEEEASKLREAYEEEMAAYNAS 189

  Fly   785 DNYGYVSKKKKRKKDRSTTDS 805
            .....|:..:...::.||..|
pombe   190 KENASVADSRVTAEETSTKPS 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
panNP_726528.2 SOX-TCF_HMG-box 713..784 CDD:238684 18/78 (23%)
SPBC28F2.11NP_595672.1 NHP6B <108..251 CDD:227935 26/111 (23%)
HMGB-UBF_HMG-box 117..184 CDD:238686 19/74 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2732
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.