DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pan and Tcf7

DIOPT Version :9

Sequence 1:NP_726528.2 Gene:pan / 43769 FlyBaseID:FBgn0085432 Length:1192 Species:Drosophila melanogaster
Sequence 2:XP_030101626.1 Gene:Tcf7 / 21414 MGIID:98507 Length:516 Species:Mus musculus


Alignment Length:585 Identity:183/585 - (31%)
Similarity:241/585 - (41%) Gaps:180/585 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   437 TPHESYSDSVKSDCEESNSAPTCIWHSTRQTFRHKKDVEPCSTAAEIILEYASLSSSSNIETSRL 501
            |....:.|.:....|:...||.|.....::|         ..:|..:::.|...|.:..      
Mouse    91 TSQRLFPDKLPESLEDGLKAPECASGMYKET---------VYSAFNLLMPYPPASGAGQ------ 140

  Fly   502 LTSASNLTDVTENYNVTTQLPIVFNYNRESSAESIVTDPLLVP---EFSTAPSTPSTGSNSGCST 563
                          :...|.|:   :|:.......|  |.|.|   .||:...||:....|    
Mouse   141 --------------HPQPQPPL---HNKPGQPPHGV--PQLSPLYEHFSSPHPTPAPADIS---- 182

  Fly   564 GMVSGIFGLSQNRRKQRLARHIETLTTNSFKSNAIRGNVDNEITNQLKTSPSIRALPTENVSHLI 628
                         :||.:.|.::|...:.|.|               .||.|:..||        
Mouse   183 -------------QKQGVHRPLQTPDLSGFYS---------------LTSGSMGQLP-------- 211

  Fly   629 TKTLSSANASLTAQELSITNLFKERLCALQGNAGSMKTEIFPMIDAPYDLSIGSKTKHMNLEAKH 693
             .|:|..:..|  ..||.:..:::...|.....|:.    :|....| .|.:||..........|
Mouse   212 -HTVSWPSPPL--YPLSPSCGYRQHFPAPTAAPGAP----YPRFTHP-SLMLGSGVPGHPAAIPH 268

  Fly   694 TS---------------NAQSNESKETTNDKKKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAA 743
            .:               |.::....:...:.|||.|||||||||||||||||||:||||||||||
Mouse   269 PAIVPSSGKQELQPYDRNLKTQAEPKAEKEAKKPVIKKPLNAFMLYMKEMRAKVIAECTLKESAA 333

  Fly   744 INQILGRRWHELSREEQSKYYEKARQERQLHMELYPGWSARDNYGYVSKKKKRKKDRSTTDSGGN 808
            ||||||||||.||||||:||||.||:||||||:||||||||||||...::.:.|...||||.|  
Mouse   334 INQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQESTTDPG-- 396

  Fly   809 NMKKCRARFGLDQQSQWCKPCRRKKKCIRYMEALNGNGPAEDGSCFDEHGSQLSDDDEDDYDDDK 873
            :.|||||||||:||:.||.|||||||||||:       |.| |.|.....|          ||..
Mouse   397 SPKKCRARFGLNQQTDWCGPCRRKKKCIRYL-------PGE-GRCPSPVPS----------DDSA 443

  Fly   874 LGGSCGSADETNKIEDEDSESLNQSMPSPGCLSGLSSLQSPSTTMSLASPLNMNANSATNVIFPA 938
            ||.....|.     :|..|..|..|.|                |..||||:.           ||
Mouse   444 LGCPRSPAP-----QDSPSYLLLPSFP----------------TELLASPVE-----------PA 476

  Fly   939 SSNALLIVGADQPTAQQRPTLVSTSGSSSGSTSSISTTPNTSSTVSPVTCMTGPCL--GSSQERA 1001
                              ||.       ||.:::: |.|...|..:|.:.:..|.:  ..||.:|
Mouse   477 ------------------PTF-------SGRSAAL-TLPAPKSPKTPHSTLQNPQIQQQESQRQA 515

  Fly  1002  1001
            Mouse   516  515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
panNP_726528.2 SOX-TCF_HMG-box 713..784 CDD:238684 63/70 (90%)
Tcf7XP_030101626.1 CTNNB1_binding 20..216 CDD:369826 34/199 (17%)
SOX-TCF_HMG-box 304..374 CDD:238684 63/69 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 134 1.000 Domainoid score I4984
eggNOG 1 0.900 - - E1_KOG3248
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000839
OrthoInspector 1 1.000 - - otm44316
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10373
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.960

Return to query results.
Submit another query.