DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pan and pop-1

DIOPT Version :9

Sequence 1:NP_726528.2 Gene:pan / 43769 FlyBaseID:FBgn0085432 Length:1192 Species:Drosophila melanogaster
Sequence 2:NP_491053.4 Gene:pop-1 / 171849 WormBaseID:WBGene00004077 Length:438 Species:Caenorhabditis elegans


Alignment Length:309 Identity:102/309 - (33%)
Similarity:152/309 - (49%) Gaps:62/309 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   674 APYDLSIGSKTKHMNLEA-KHTSN-AQSNESKETTND---KKKPHIKKPLNAFMLYMKEMRAKVV 733
            ||.::..|.....|.:.. .|.|: |..|..:.....   ||..|:||||||||.:|||.|..::
 Worm   147 APLNMRAGHPMNQMGMPPYMHPSSMAPQNVDRRAQGGGKAKKDDHVKKPLNAFMWFMKENRKALL 211

  Fly   734 AEC--TLKESAAINQILGRRWHELSREEQSKYYEKARQERQLHMELYPGWSARDNYGYVSKKKKR 796
            .|.  ..|:||.:|:.||:|||:||:|||:||:|.|:::::.|.|.||.||||:||....||.|:
 Worm   212 EEIGNNEKQSAELNKELGKRWHDLSKEEQAKYFEMAKKDKETHKERYPEWSARENYAVNKKKTKK 276

  Fly   797 KKDRSTTDSGGNNMKKCRARFGLDQQSQWCKPCRRKKKCIRYMEALNGNGPAEDGSCFDEHGSQL 861
            ::|:| ..|..|:.||||||||::....|||.|:|||||                          
 Worm   277 RRDKS-IPSENNDQKKCRARFGVNNTEMWCKFCKRKKKC-------------------------- 314

  Fly   862 SDDDEDDYDDDKLGGSCGSADETNKIEDEDSE---SLNQSMPSPGCLSG--LSSLQSPST---TM 918
                  :|..|:.|||    |.|:..:...:.   |.:...|||...:|  |::.|..:.   ||
 Worm   315 ------EYATDRSGGS----DITDSQDGRGTSGAYSSSSESPSPKANAGIALTTQQQQAAMMHTM 369

  Fly   919 SLASPLNMNANSATNVIFPASSNALLIVGADQPTAQQRPTLVSTSGSSS 967
            .:...|.....::|:|..|.:|:          :|.:.|...:.|.|.|
 Worm   370 LMQMRLGSTTGASTHVPSPLASS----------SAGRSPLDANASDSES 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
panNP_726528.2 SOX-TCF_HMG-box 713..784 CDD:238684 38/72 (53%)
pop-1NP_491053.4 SOX-TCF_HMG-box 191..264 CDD:238684 38/72 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156090
Domainoid 1 1.000 81 1.000 Domainoid score I5490
eggNOG 1 0.900 - - E1_KOG3248
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4297
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000839
OrthoInspector 1 1.000 - - oto18331
orthoMCL 1 0.900 - - OOG6_107890
Panther 1 1.100 - - LDO PTHR10373
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2732
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.770

Return to query results.
Submit another query.