DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS3A and CYLD

DIOPT Version :9

Sequence 1:NP_001245404.1 Gene:RpS3A / 43768 FlyBaseID:FBgn0017545 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_609371.2 Gene:CYLD / 34380 FlyBaseID:FBgn0032210 Length:639 Species:Drosophila melanogaster


Alignment Length:136 Identity:24/136 - (17%)
Similarity:48/136 - (35%) Gaps:62/136 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 RKTCYAQQSQVRKIRARMTDIITNEVSG-----ADLKQLVN------------------------ 189
            ||..:.:..:|.|:|..:..:  :.|||     .|.::.:|                        
  Fly   332 RKNVFVRSDRVMKLRELLDQL--SSVSGLTCEEKDPEEFLNSLLSQIMRVEPFLKLSSGQDSYFY 394

  Fly   190 --------KLALDSIAKDIEKSCQRIYPLHDVYIRKVK---VLKKPRF----------------D 227
                    ||.|.|:.:..|:|    :...|:.:::|.   :::.|||                |
  Fly   395 QLFVEKDEKLTLPSVQQLFEQS----FHSSDIKLKEVPSCFIIQMPRFGKNYKMYPRILPSQVLD 455

  Fly   228 VSKLLE 233
            |:.::|
  Fly   456 VTDIIE 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS3ANP_001245404.1 Ribosomal_S3Ae 21..224 CDD:395802 18/109 (17%)
CYLDNP_609371.2 CAP_GLY 143..219 CDD:214997
Peptidase_C19N 276..631 CDD:239135 24/136 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11830
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.