DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ci and ELF6

DIOPT Version :9

Sequence 1:NP_524617.3 Gene:ci / 43767 FlyBaseID:FBgn0004859 Length:1397 Species:Drosophila melanogaster
Sequence 2:NP_196044.2 Gene:ELF6 / 830303 AraportID:AT5G04240 Length:1340 Species:Arabidopsis thaliana


Alignment Length:628 Identity:135/628 - (21%)
Similarity:210/628 - (33%) Gaps:187/628 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 RTNSASSFHDPYVNCASAFHLAGLGLGSADFLGSRGLSSLGELHNAAVAAAAAGSLASTDFHFSV 191
            |.||      |......|..|.||...::..|....:..|.....:....::..|....: |..|
plant   746 RKNS------PTKKIQHALSLGGLFSDTSQMLDFTTIRWLQRKSRSKAKPSSTSSFTPCE-HLEV 803

  Fly   192 --DGNRRLGSPRPPGGSIRASI--SRKRALSSSP------------YSDSFDINSMIRFSPNS-- 238
              ||..|.......|......|  |||:.|:..|            .|..|| .:...||..|  
plant   804 KADGKLRDNLDSQTGKKEEKIIQYSRKKKLNPKPSAEQVQELATLAKSKDFD-KTCKNFSSRSHL 867

  Fly   239 ---LATIMNGSRGSS-------------AASGSYGH--------------ISATALNPMSHVH-- 271
               :.:.||...|.|             ::|.:.||              :.....|.:|.|:  
plant   868 DSAIRSEMNSEIGDSGRVIGVSFSINPCSSSFTVGHGQEHPEITVKFGSDLDGNVTNSLSMVNGD 932

  Fly   272 -------STRLQQIQAHLLRASAGLLNPMTPQQVAASGFSIGHMPTSASLRVN--DVHP---NLS 324
                   |...:|.|.|.:.::....|         ||   .|:..|.::.|:  |.|.   .||
plant   933 SADLTLTSISREQHQGHSMTSNNNGSN---------SG---SHVVASQTILVSTGDNHDGPRKLS 985

  Fly   325 DSHIQITTSPTVTKDVSQVPAAAF-----SLKNLDDAREKKGPFKDVVPEQPSSTSGGVAQVEAD 384
            ..::....|....::..::....|     ::.|::|.::.    :.|.|.|..:..|...|||..
plant   986 GDYVCSDVSVRGIQEAVEMSDQEFGEPRSTVTNIEDEQQS----QIVKPTQREAVFGDHEQVEGA 1046

  Fly   385 SASSQLSDRC------------------------YNNVVNNIT--GIP---GDVKVNSRLDEYIN 420
            .|.|...:.|                        ..|:|.::|  |.|   .|:..:|..||..:
plant  1047 EAVSTRENLCSEIILHTEHSSAHVGMEIPDINTASENLVVDMTHDGEPLESSDILSSSNGDEASS 1111

  Fly   421 CGSISIP---SNEYDCANADTTDIKDEPGDF------------IETNCHWRSCRIEFI------- 463
            .|...:.   |.|.:.::::.|::.:.|...            .|||.:..| .|.||       
plant  1112 NGLQVLNDELSMESEVSSSENTEVIEAPNSMGEAKKKRKIESESETNDNPES-SIGFIRSPCEGL 1175

  Fly   464 ------------------TQDELVKHI--------------NNDHIQTNKKAFVCRWEDCTRGEK 496
                              |.||..|.|              ....:.|......|..|.|   :.
plant  1176 RSRGKRKATCETSLKHTETSDEEKKPIAKRLKKTPKACSGSRQQEVPTTTHPNRCYLEGC---KM 1237

  Fly   497 PFKAQYMLVVHMRRHTGEKPHKCTFEGCFKAYSRLENLKTHLRSHTGEKPYTCEYPGCSKAFSNA 561
            .|:::..|..|.|       ::||.|||.|.:...:.|..|.|.|..|:|:.|.:.|||..|...
plant  1238 TFESKAKLQTHKR-------NRCTHEGCGKKFRAHKYLVLHQRVHKDERPFECSWKGCSMTFKWQ 1295

  Fly   562 SDRAKHQNRTHSNEKPYICKAPGCTKRYTDPSSLRKH-VKTVH 603
            ..|.:|. |.|:.|:|||||..||...:...|...:| .||:|
plant  1296 WARTEHL-RLHTGERPYICKVDGCGLSFRFVSDYSRHRRKTMH 1337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ciNP_524617.3 zf-H2C2_2 503..530 CDD:290200 9/26 (35%)
C2H2 Zn finger 519..541 CDD:275368 9/21 (43%)
zf-H2C2_2 533..560 CDD:290200 11/26 (42%)
C2H2 Zn finger 549..572 CDD:275368 8/22 (36%)
C2H2 Zn finger 580..601 CDD:275368 6/21 (29%)
ELF6NP_196044.2 JmjN 17..50 CDD:396793
JmjC 292..411 CDD:396791
C2H2 Zn finger 1230..1255 CDD:275368 8/34 (24%)
C2H2 Zn finger 1253..1275 CDD:275368 9/21 (43%)
C2H2 Zn finger 1283..1305 CDD:275368 8/22 (36%)
C2H2 Zn finger 1313..1333 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.