DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ci and ZXDA

DIOPT Version :9

Sequence 1:NP_524617.3 Gene:ci / 43767 FlyBaseID:FBgn0004859 Length:1397 Species:Drosophila melanogaster
Sequence 2:NP_009087.1 Gene:ZXDA / 7789 HGNCID:13198 Length:799 Species:Homo sapiens


Alignment Length:461 Identity:105/461 - (22%)
Similarity:169/461 - (36%) Gaps:123/461 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   453 CHWRSCRIEFITQDELVKHINNDHIQTNKKAFVCRWEDCTRGEKPFKAQYMLVVHMRRHTGEKPH 517
            |.:..|:..|||...|..| |..|.: .::.|.|.:..|:   |.:.....|.:|:|.||||:|.
Human   391 CAFSGCKKTFITVSALFSH-NRAHFR-EQELFSCSFPGCS---KQYDKACRLKIHLRSHTGERPF 450

  Fly   518 KCTFEGCFKAYSRLENLKTHLRSHTGEKPYTCEYPGCSKAFSNASDRAKHQNRTHSNEKPYICKA 582
            .|.|:||...::.:..|..|.|.|..::.:.|...||.|:|:.| :..|..:.||...||::|..
Human   451 LCDFDGCGWNFTSMSKLLRHKRKHDDDRRFMCPVEGCGKSFTRA-EHLKGHSITHLGTKPFVCPV 514

  Fly   583 PGCTKRYTDPSSLRKHVKTVHGAEFYANKKH--------KGLPLNDANSRLQQNNSRHNLQEHNI 639
            .||..|::..|||..|           :|||        ...|::..|...   .|:|:::.|.:
Human   515 AGCCARFSARSSLYIH-----------SKKHLQDVDTWKSRCPISSCNKLF---TSKHSMKTHMV 565

  Fly   640 DSSPCSEDSHLGKMLGTSSPSIKSESDISSSNHHLVNGVRASDSLLTYSPDDL--AENLNLDDGW 702
            ......:|. |.::                   ...|.:..|..|.:...:||  ||.::|    
Human   566 KRHKVGQDL-LAQL-------------------EAANSLTPSSELTSQRQNDLSDAEIVSL---- 606

  Fly   703 NCDDDVDVADLPIVLRAMVNIG----NGNASASTIGGSVLARQRFRGRLQTKGINSSTIMLCNIP 763
             ..|..|.....::..|:||.|    :..:.:||:.|                         ::|
Human   607 -FSDVPDSTSAALLDTALVNSGILTIDVASVSSTLAG-------------------------HLP 645

  Fly   764 ESNRTFGISELNQRITELKMEPGTDAEIKIPKLPNTTIGGYTEDPLQN-QTS-FRNTVSNKQGTV 826
            .:|        |..:.:....|...|               |.||.|: .|| |..|.:      
Human   646 ANN--------NNSVGQAVDPPSLMA---------------TSDPPQSLDTSLFFGTAA------ 681

  Fly   827 SGSIQGQFRRDSQNSTASTYYGSMQSRRSSQSSQVSSIPTMRPNPSCNSTASFYDPISPG---CS 888
            :|..|.....|..:|.:....||:.|.....||......|    ||...|.. .|.::|.   |.
Human   682 TGFQQSSLNMDEVSSVSVGPLGSLDSLAMKNSSPEPQALT----PSSKLTVD-TDTLTPSSTLCE 741

  Fly   889 RRSSQM 894
            ...|::
Human   742 NSVSEL 747

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ciNP_524617.3 zf-H2C2_2 503..530 CDD:290200 12/26 (46%)
C2H2 Zn finger 519..541 CDD:275368 7/21 (33%)
zf-H2C2_2 533..560 CDD:290200 9/26 (35%)
C2H2 Zn finger 549..572 CDD:275368 7/22 (32%)
C2H2 Zn finger 580..601 CDD:275368 8/20 (40%)
ZXDANP_009087.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..89
Required for interaction with ZXDC. /evidence=ECO:0000269|PubMed:17493635 267..573 56/201 (28%)
C2H2 Zn finger 269..291 CDD:275368
zf-C2H2_aberr 300..445 CDD:293622 16/58 (28%)
zf-C2H2 300..324 CDD:278523
C2H2 Zn finger 302..324 CDD:275368
C2H2 Zn finger 332..354 CDD:275368
zf-H2C2_2 346..369 CDD:290200
C2H2 Zn finger 362..382 CDD:275368
C2H2 Zn finger 391..413 CDD:275368 8/22 (36%)
C2H2 Zn finger 425..444 CDD:275368 5/21 (24%)
COG5048 <437..568 CDD:227381 43/145 (30%)
C2H2 Zn finger 452..474 CDD:275368 7/21 (33%)
zf-H2C2_2 467..493 CDD:290200 9/25 (36%)
C2H2 Zn finger 482..504 CDD:275368 7/22 (32%)
C2H2 Zn finger 512..534 CDD:275370 9/32 (28%)
Required for transcriptional activation 572..699 36/205 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157353
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.