DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ci and iec1

DIOPT Version :9

Sequence 1:NP_524617.3 Gene:ci / 43767 FlyBaseID:FBgn0004859 Length:1397 Species:Drosophila melanogaster
Sequence 2:NP_594663.1 Gene:iec1 / 2542854 PomBaseID:SPAC144.02 Length:249 Species:Schizosaccharomyces pombe


Alignment Length:241 Identity:63/241 - (26%)
Similarity:91/241 - (37%) Gaps:79/241 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   424 ISIPSNEYDCANADTTDIKDEPGDFIETNCHWRSCRIEFITQDELVKHINN-------------- 474
            :||.|:..........|::.|.    ||.|||:||..:.:|.|.||.||:|              
pombe     1 MSISSDTSGSVPGSPIDLEPES----ETICHWQSCEQDLLTLDNLVHHIHNGTTSNLRLISNINS 61

  Fly   475 --DHIQTNKKAFVCRWEDCTRGEKPFKAQYMLVVHMRRHTGEKPHKCTFEGCFKAYSRLENLKTH 537
              |||...:..:.|.|:||.|......:::.||                              .|
pombe    62 ILDHIGNRRPKYTCEWDDCPRKGMVQTSRFALV------------------------------AH 96

  Fly   538 LRSHTGEKPYTCEYPGCSKAFSNASDRAKHQNRTHSNEKPYICKAPGCTKRYTDPSSLRKHVKTV 602
            |||||||||:.|..|.|.::|:.:...|||....|..:          |.|.:||          
pombe    97 LRSHTGEKPFICSVPECDRSFTRSDALAKHMRTVHEAD----------TLRPSDP---------- 141

  Fly   603 HGAEFYANKKHKGLPLNDANSRLQQ-NNSRHNLQEHNIDSSPCSED 647
                  ..|.|...|.|.||:.:|. ..:|...|.|.:.::  :||
pombe   142 ------IPKAHPMHPQNVANAMVQSAREARAQQQMHGVGNT--NED 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ciNP_524617.3 zf-H2C2_2 503..530 CDD:290200 2/26 (8%)
C2H2 Zn finger 519..541 CDD:275368 3/21 (14%)
zf-H2C2_2 533..560 CDD:290200 14/26 (54%)
C2H2 Zn finger 549..572 CDD:275368 7/22 (32%)
C2H2 Zn finger 580..601 CDD:275368 4/20 (20%)
iec1NP_594663.1 COG5048 1..>249 CDD:227381 63/241 (26%)
zf-H2C2_2 92..119 CDD:290200 16/56 (29%)
C2H2 Zn finger 108..129 CDD:275368 7/20 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R588
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.