DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ci and GLIS3

DIOPT Version :9

Sequence 1:NP_524617.3 Gene:ci / 43767 FlyBaseID:FBgn0004859 Length:1397 Species:Drosophila melanogaster
Sequence 2:NP_001035878.1 Gene:GLIS3 / 169792 HGNCID:28510 Length:930 Species:Homo sapiens


Alignment Length:833 Identity:219/833 - (26%)
Similarity:307/833 - (36%) Gaps:264/833 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PG-SPCINQHHPTDVSSSVTVPSIIPTGG-------TSDS------------IKTSIQPQICNEN 80
            || |||.:...||..|.:..:...:|:||       .::|            :.|:.:|:.  :.
Human    38 PGPSPCGSTSSPTMASLANNLHLKMPSGGGMAPQNNVAESRIHLPALSPRRQMLTNGKPRF--QV 100

  Fly    81 TLLGNAGHQHNHQPQH-----------------------------VHNINVTGQPHDFH------ 110
            |..|.....|..:|:.                             .:|:.||..|....      
Human   101 TQAGGMSGSHTLKPKQQEFGSPFPPNPGKGALGFGPQCKSIGKGSCNNLVVTSSPMMVQRLGLIS 165

  Fly   111 -PAYRIPGYMEQLY-SLQRTNSASSFHDPYVNCASAFHLAGLGLGSADFLGSRGLSS-------- 165
             ||.::.....|:. ||||..:|::.:.|..:..|......|...:.....|:..||        
Human   166 PPASQVSTACNQISPSLQRAMNAANLNIPPSDTRSLISRESLASTTLSLTESQSASSMKQEWSQG 230

  Fly   166 -----------------LGELHNAAVAAAAAGSLASTDFHFSVDGNRRLGSPRP-PGGS---IRA 209
                             ||:|.:.....:.:.:..|......:.|.....||.| |..|   ..:
Human   231 YRALPSLSNHGSQNGLDLGDLLSLPPGTSMSSNSVSNSLPSYLFGTESSHSPYPSPRHSSTRSHS 295

  Fly   210 SISRKRALSSSPYSD--SFDINSMIRFSPNSLATIMNGSRGSSAASGSYGHISATALNPMSHVHS 272
            :.|:|||||.||.||  ..|.|::||.||.||...:||||.|.|           .|:|...|: 
Human   296 ARSKKRALSLSPLSDGIGIDFNTIIRTSPTSLVAYINGSRASPA-----------NLSPQPEVY- 348

  Fly   273 TRLQQIQAHLLRASAGLLNPMTPQQVAASGFSIGHMPTSASLRVNDVHPNLSDSHIQITTSPTVT 337
                   .|.|    |:.....||.....|...|.:.....|.:                 |...
Human   349 -------GHFL----GVRGSCIPQPRPVPGSQKGVLVAPGGLAL-----------------PAYG 385

  Fly   338 KDVSQVPAAAFS---LKNLDDAREKKGPFKDVVPEQ----PSSTSGGVAQVEADSASSQLSDRCY 395
            :|      .|..   ::.|:....:.|....:|.:.    |.|.|.|:.:.|             
Human   386 ED------GALEHERMQQLEHGGLQPGLVNHMVVQHGLPGPDSQSAGLFKTE------------- 431

  Fly   396 NNVVNNITGIPGDVKVNSRLDEYINCGSISIP--------------------------------S 428
                              ||:|:.. .::.:|                                :
Human   432 ------------------RLEEFPG-STVDLPPAPPLPPLPPPPGPPPPYHAHAHLHHPELGPHA 477

  Fly   429 NEYDCANADTTDIKDEPGDFIETNCHWRSCRIEFITQDELVKHINNDHIQTNK-KAFVCRWEDCT 492
            .:.....|...|..:..|...:..|.|..|...:..|:|||:||...||...| :.|.|.|..|.
Human   478 QQLALPQATLDDDGEMDGIGGKHCCRWIDCSALYDQQEELVRHIEKVHIDQRKGEDFTCFWAGCP 542

  Fly   493 RGEKPFKAQYMLVVHMRRHTGEKPHKCTFEGCFKAYSRLENLKTHLRSHTGEKPYTCEYPGCSKA 557
            |..|||.|:|.|::|||.|:||||:|||||||.||:|||||||.|||||||||||.|::|||.||
Human   543 RRYKPFNARYKLLIHMRVHSGEKPNKCTFEGCEKAFSRLENLKIHLRSHTGEKPYLCQHPGCQKA 607

  Fly   558 FSNASDRAKHQNRTHSNEKPYICKAPGCTKRYTDPSSLRKHVKTVHGAEFYANKK-------HKG 615
            |||:||||||| |||.:.|||.|:.||||||||||||||||||.....|..|.||       |..
Human   608 FSNSSDRAKHQ-RTHLDTKPYACQIPGCTKRYTDPSSLRKHVKAHSSKEQQARKKLRSSTELHPD 671

  Fly   616 L--------------------------------------PLNDANSRLQQNNS----------RH 632
            |                                      |:..:|...:...:          .|
Human   672 LLTDCLTVQSLQPATSPRDAAAEGTVGRSPGPGPDLYSAPIFSSNYSSRSGTAAGAVPPPHPVSH 736

  Fly   633 NLQEHNIDSSPCSEDSHLGKMLGTSSPSIKSESDISSSNHHLVNGVRASDSLL 685
            ....||:..||.:..|.|..:....:.:.:......|.:|.....|.|..|:|
Human   737 PSPGHNVQGSPHNPSSQLPPLTAVDAGAERFAPSAPSPHHISPRRVPAPSSIL 789

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ciNP_524617.3 zf-H2C2_2 503..530 CDD:290200 18/26 (69%)
C2H2 Zn finger 519..541 CDD:275368 18/21 (86%)
zf-H2C2_2 533..560 CDD:290200 21/26 (81%)
C2H2 Zn finger 549..572 CDD:275368 17/22 (77%)
C2H2 Zn finger 580..601 CDD:275368 18/20 (90%)
GLIS3NP_001035878.1 zf-H2C2_2 554..580 CDD:290200 18/25 (72%)
C2H2 Zn finger 569..591 CDD:275368 18/21 (86%)
zf-H2C2_2 583..610 CDD:290200 21/26 (81%)
C2H2 Zn finger 599..621 CDD:275368 17/22 (77%)
C2H2 Zn finger 629..651 CDD:275368 19/21 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45718
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R588
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.