DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ci and GLIS1

DIOPT Version :9

Sequence 1:NP_524617.3 Gene:ci / 43767 FlyBaseID:FBgn0004859 Length:1397 Species:Drosophila melanogaster
Sequence 2:NP_001377765.1 Gene:GLIS1 / 148979 HGNCID:29525 Length:803 Species:Homo sapiens


Alignment Length:714 Identity:203/714 - (28%)
Similarity:269/714 - (37%) Gaps:244/714 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 PQHVHNINVTGQPHDFHPA-------------YRIPGYMEQLYSLQRTNS------------ASS 133
            |...|::.....|.|:.|:             :|.||..:.|..|.....            |.|
Human    61 PPRAHDLLRPRSPRDYGPSKAAAAGKVNGSYGHRTPGSEKSLLDLDLAEGPGPTCCQGLFLPAGS 125

  Fly   134 -------------FHDPYVNCA---SAFHLAGLGLGSADFLGSRGLSSLGELHNA--AVAAAAAG 180
                         .|.|:.:.:   .|.::.| .|.:...:....|.....:..|  :::|...|
Human   126 PPPRAHPQACERLLHFPHPDRSPRPQATYVNG-SLPTTQHIKQESLPDYQAMAEARTSLSAHCRG 189

  Fly   181 SLASTDFHFSVD-GNRRLGSPRP---------------------PGGSIR----ASISRKRALSS 219
            .|| |..|..:| ..|.|.:|.|                     |.||::    ..:......||
Human   190 PLA-TGLHPDLDLPGRSLATPAPSCYLLGSEPSSGLGLQPETHLPEGSLKRCCVLGLPPTSPASS 253

  Fly   220 SPYSDSFDINSMIRFSPNSLATIMNGSRGSSAASGSYGHISATALNPMSHVHSTRLQQIQAHLLR 284
            ||.:.| |:.|:||.|..||.|.:||.| |...:|..|                           
Human   254 SPCASS-DVTSIIRSSQTSLVTCVNGLR-SPPLTGDLG--------------------------- 289

  Fly   285 ASAGLLNPMTPQQVAASGFSIGHMPTSASLRVNDVHPNLSDSH---IQITTSPTVTKDVSQVPAA 346
                     .|.:.|..|                  |..:|||   :|:......: .:.|.||.
Human   290 ---------GPSKRARPG------------------PASTDSHEGSLQLEACRKAS-FLKQEPAD 326

  Fly   347 AFSLKNLDDAREKKGPFKDVVPE-------QPSSTSGGVAQVEADSASSQLSDRCYNNVVNNITG 404
            .||        |..||.:..:|.       .|..:.||:.                       .|
Human   327 EFS--------ELFGPHQQGLPPPYPLSQLPPGPSLGGLG-----------------------LG 360

  Fly   405 IPGDVKVNSRLDEYINCGSISIPSNEYDCANADTTDIKDEPGDFIETNCHWRSCRIEFITQDELV 469
            :.|.|....:.                                     |.|..|...:..|:|||
Human   361 LAGRVVAGRQA-------------------------------------CRWVDCCAAYEQQEELV 388

  Fly   470 KHINNDHIQTNK-KAFVCRWEDCTRGEKPFKAQYMLVVHMRRHTGEKPHKC--------TFEGCF 525
            :||...||...| :.|.|.|..|.|..|||.|:|.|::|||.|:||||:||        .||||.
Human   389 RHIEKSHIDQRKGEDFTCFWAGCVRRYKPFNARYKLLIHMRVHSGEKPNKCMPFPQFFHEFEGCS 453

  Fly   526 KAYSRLENLKTHLRSHTGEKPYTCEYPGCSKAFSNASDRAKHQNRTHSNEKPYICKAPGCTKRYT 590
            ||:|||||||.|||||||||||.|::|||.|||||:||||||| |||.:.|||.|:.|||:||||
Human   454 KAFSRLENLKIHLRSHTGEKPYLCQHPGCQKAFSNSSDRAKHQ-RTHLDTKPYACQIPGCSKRYT 517

  Fly   591 DPSSLRKHVKTVHGAEFYANKK-HKGLPLNDANSR-----LQQNNSRHNL------------QEH 637
            ||||||||||.....|....|| |.| |..:|:..     |||.::...|            ||.
Human   518 DPSSLRKHVKAHSAKEQQVRKKLHAG-PDTEADVLTECLVLQQLHTSTQLAASDGKGGCGLGQEL 581

  Fly   638 NIDSSPCSEDSHLGKMLGTSSPSIKSESDISSSNHHLVNGVRASDSLLTYSPDDLAENLNLDDG 701
            .....|.|...|.|...|...|:    .|: .|.||.::...:|...|  ||..:||:..  ||
Human   582 LPGVYPGSITPHNGLASGLLPPA----HDV-PSRHHPLDATTSSHHHL--SPLPMAESTR--DG 636

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ciNP_524617.3 zf-H2C2_2 503..530 CDD:290200 17/34 (50%)
C2H2 Zn finger 519..541 CDD:275368 17/29 (59%)
zf-H2C2_2 533..560 CDD:290200 21/26 (81%)
C2H2 Zn finger 549..572 CDD:275368 17/22 (77%)
C2H2 Zn finger 580..601 CDD:275368 17/20 (85%)
GLIS1NP_001377765.1 C2H2 Zn finger 376..395 CDD:275368 7/18 (39%)
C2H2 Zn finger 406..431 CDD:275368 13/24 (54%)
COG5048 447..>522 CDD:227381 57/75 (76%)
C2H2 Zn finger 450..469 CDD:275368 15/18 (83%)
C2H2 Zn finger 477..499 CDD:275368 17/22 (77%)
C2H2 Zn finger 507..529 CDD:275368 18/21 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45718
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R588
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.