DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PlexB and plxna3

DIOPT Version :9

Sequence 1:NP_001245400.1 Gene:PlexB / 43766 FlyBaseID:FBgn0025740 Length:2051 Species:Drosophila melanogaster
Sequence 2:NP_001006866.1 Gene:plxna3 / 448633 XenbaseID:XB-GENE-856557 Length:429 Species:Xenopus tropicalis


Alignment Length:395 Identity:101/395 - (25%)
Similarity:177/395 - (44%) Gaps:83/395 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 PVQSTASSYGNRSIGNNIE-----SVRDSQSKNYFTHMSFDFMHNVLFAGATNKILKLNENLRVL 117
            |:||....:...|:|....     :|.|:.    .||::.......::.||.|:|.||:|||..|
 Frog     3 PLQSLLLLFLTCSVGEGASVFPTFAVSDTS----LTHLAVHKHTGDVYLGAVNRIFKLSENLTEL 63

  Fly   118 AEAVTGPLHDSPQCHAGGCPEDI-----ETSLVNNFNKILVVSYAHDGILIACGSIRQGACEIYS 177
            ...:|||:.|:..|:.   |..:     :.|..:|.|::|::.|....: :||||:.||.|:...
 Frog    64 RSHLTGPIADNSSCYP---PPSVRVCTHKLSPTDNVNRLLLIDYTGKRV-VACGSVWQGICQFLR 124

  Fly   178 LPRF----------------PATPQFFAVPLAANDENASTYAFVGPARYAWKEEDILYVGTTFTN 226
            |...                ...|...|..:...|                .|:..|::||:...
 Frog   125 LDDLFKLGEPHHRKEHYLSGAREPDSMAGVIVDQD----------------VEQSKLFIGTSIDG 173

  Fly   227 VGDYRHDVPAISSRRL--DDLNYAEFSI--QQSIINIDVK-------YRDHFLVDYIYGFNSSEY 280
            ..:|   .|.:|||||  |:.:...|.:  |...::..:|       ....|.:.|:|||.|..:
 Frog   174 KSEY---FPTLSSRRLVQDEESAEMFRLVYQDEFVSSQIKVPSDTLSLHPSFDIYYVYGFVSKIF 235

  Fly   281 AYFIIVQ--KKSHLADEAG---YVTRLARICITDPNYDSYTEITVQCTATENNVDYNIVRDAKVT 340
            .||:.:|  .:..|.|..|   :.:::.|:|..|..:.||.|..:.|  |::.|:|.:::.|.::
 Frog   236 VYFLTLQLDTQQTLLDATGEKFFTSKIVRMCSGDLEFYSYVEFPIGC--TKDGVEYRLIQSAYLS 298

  Fly   341 PASHKLAQKMGIKKDDHVLVTVFSPSREISNQPESKSAMCIYSIKDIEDMFIENIHL------CF 399
            ....||||.:||.:|:.||.||||..::..:.|..:|.:|::::..|      |:|:      |:
 Frog   299 RPGRKLAQALGIPEDEEVLFTVFSQGQKNRSNPPRESVLCLFTLSQI------NLHIKMRIQSCY 357

  Fly   400 NGTTK 404
            :|..|
 Frog   358 HGEGK 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PlexBNP_001245400.1 Sema_plexin_like 86..534 CDD:200497 94/362 (26%)
PSI 535..586 CDD:279745
PSI 683..730 CDD:214655
PSI 836..877 CDD:214655
IPT_plexin_repeat1 888..976 CDD:238585
IPT_plexin_repeat2 977..1095 CDD:238584
IPT_plexin_repeat3 1097..1211 CDD:238586
Plexin_cytopl 1452..2017 CDD:285529
plxna3NP_001006866.1 Sema 22..>378 CDD:326631 96/376 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11022
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000391
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22625
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.100

Return to query results.
Submit another query.