DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PlexB and LOC108179158

DIOPT Version :9

Sequence 1:NP_001245400.1 Gene:PlexB / 43766 FlyBaseID:FBgn0025740 Length:2051 Species:Drosophila melanogaster
Sequence 2:XP_017210788.1 Gene:LOC108179158 / 108179158 -ID:- Length:321 Species:Danio rerio


Alignment Length:383 Identity:72/383 - (18%)
Similarity:126/383 - (32%) Gaps:155/383 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 FAGATNKILKLNEN----LRVLAEAVTGPLHDSPQCHAGGCPEDIETSLVNNFNKI-LVVSYAHD 159
            |.....|:..|.||    :|          ||..:       |..:..:.|:.:.: ::|.:..:
Zfish    30 FVVGNGKLFVLTENRLYQMR----------HDLSE-------EKKKNDINNSTHPVNILVPFDDN 77

  Fly   160 GILIACGSIRQGACEIYSLPRFPATPQFFAVPLAANDENASTY----AFVGPARYAWKEEDILYV 220
            |.||.||:...|.||:                |..||...|.|    .|:||..   .|:.:.::
Zfish    78 GTLITCGTYEDGYCEV----------------LDINDIKNSIYYESNLFIGPKE---TEKSVAFI 123

  Fly   221 GTTFTNVGDYRHDVPAISSRRLDD---------------------LNYAEFSIQ---QSIINIDV 261
            ..|.::    |:   .:..::||.                     |:|||...:   ||..| ||
Zfish   124 AGTSSS----RY---LLIGKKLDQSTSQSPVVRLWNTLQTQFGGILSYAEQGSEPAIQSTAN-DV 180

  Fly   262 KYRDHFLVDYIYGF---NSSEYAYFIIVQKKSHLADEAGYVTRLARICITDPNYDSYTEITVQCT 323
            |:.|        ||   :||:...|:..:..|.         |...:...:.:..:.:||     
Zfish   181 KFVD--------GFQRASSSDLYLFLNTKTDSE---------RKVHVLWMNSSKSTKSEI----- 223

  Fly   324 ATENNVDYNIVRDAKVTPASHK----LAQKMGIKKDDHVL-VTVFSPSREISNQPESKSAMCIYS 383
                   :..::.|.:...|.|    |.....|..:..|: ..|||...:  ..||: :|:.:|:
Zfish   224 -------FKSLQSAVIKCCSDKARPVLVSSAVIPSEKAVIWAGVFSAQDQ--QDPEN-TALALYN 278

  Fly   384 IKDIEDMFIENIHLCFNGTTKDRNLGYISGTINDGRCPIVGSLGNIYNFCSVGLKISG 441
            |..|:                                      |.:..||:.|.::.|
Zfish   279 ISRIQ--------------------------------------GRVKEFCAAGERMCG 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PlexBNP_001245400.1 Sema_plexin_like 86..534 CDD:200497 72/383 (19%)
PSI 535..586 CDD:279745
PSI 683..730 CDD:214655
PSI 836..877 CDD:214655
IPT_plexin_repeat1 888..976 CDD:238585
IPT_plexin_repeat2 977..1095 CDD:238584
IPT_plexin_repeat3 1097..1211 CDD:238586
Plexin_cytopl 1452..2017 CDD:285529
LOC108179158XP_017210788.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D90434at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.