DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PlexB and plxnb2a.2

DIOPT Version :9

Sequence 1:NP_001245400.1 Gene:PlexB / 43766 FlyBaseID:FBgn0025740 Length:2051 Species:Drosophila melanogaster
Sequence 2:NP_001107960.1 Gene:plxnb2a.2 / 100034640 ZFINID:ZDB-GENE-041210-159 Length:477 Species:Danio rerio


Alignment Length:562 Identity:137/562 - (24%)
Similarity:215/562 - (38%) Gaps:153/562 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 VNNFNKILVVSYAHDGILIACGSIRQGACEIYSLPRFPATPQFFAVPLAANDENASTYAFVGPAR 209
            ::||||:|.|    :.:||.||.:.:|.|.:.:|                |..|...|.......
Zfish     1 MDNFNKLLQV----NSVLIVCGILFRGICSLVNL----------------NSVNKPVYYSDTERE 45

  Fly   210 YAW---KEEDILYVG--------TTFTNVGDY--------RHDVPAISSRRLDDLNYAEFSIQQS 255
            ..|   .||.:..||        ||..|:..:        ......||:..|.:  :.|..:.::
Zfish    46 KTWVASTEESVTVVGVISYFKDTTTNANLSVFLVGKGFGSSDSSKLISTWLLQE--HGEMDVFEN 108

  Fly   256 IINIDVKYRDHFL----VDYIYGFNSSEYAYFIIVQKKSHLAD--EAGYVTRLARICITDPNYDS 314
            ::.........|:    .|:.|.|.::.|.|.:.    ||.|.  .:..:|.:||:...|.:|.|
Zfish   109 MVEASTVQASAFVHRYHHDFRYTFKNNGYIYLLF----SHTASTRHSRKITFIARLSKNDHHYYS 169

  Fly   315 YTEITVQCTA-TENNVD-YNIVRDAKVTPASHKLAQK-MGIKKDDHVLVTVFSPSREISNQPESK 376
            |||:.:.||. ||...: :|.|:.|.:......|||. :....:|.||..|||...|     :.:
Zfish   170 YTELQLNCTINTEQQENTFNKVQAAYLAKPGKVLAQNIVPSNLNDKVLFGVFSADEE-----DGR 229

  Fly   377 SAMCIYSIKDIEDMFIENIHLCFNG------------------------TTKDRNL--GYISGTI 415
            ||:|:|.:..|...|.|.|..|:.|                        |.:|:|:  .||.|. 
Zfish   230 SALCMYPLSSINARFEEVIESCYTGEVLEDDKPKTVYSPYNSKNEAICRTKRDKNMVKAYICGA- 293

  Fly   416 NDGRCPIVGSLGNIYNFCSVGLKISGVSPIT-------AHALFHFDNVSVTSVTATSTTDQQHSL 473
                           .|..        ||:.       |..|.:..|..:|:|..  ..:.:|::
Zfish   294 ---------------EFLP--------SPLASKPEYALAVKLIYTGNDMLTAVAV--AVENEHTV 333

  Fly   474 AFLGTNMGVIKKVLLSGQSPGEYEEIVVD-AGNRILPNTMMSPKKDFLYVLSQRKITKLRIEHCS 537
            |||||:...:.||.|.......|..|... .|..:..|.:.....|.||:.:.|||:|:.::.|.
Zfish   334 AFLGTSGADVLKVHLDPNHTDFYNRIPGQRTGGAVNKNLLFDTGLDHLYITTGRKISKVPVQVCG 398

  Fly   538 VYTNCSACLESRDPFCGWCSLEKRCTVRSTCQRDTSASRWLSLGSGQQCIEFESIIPEKIPISEL 602
            ...:|.:||..:||:||||..|.|||.:..|.:....:.|| .|..|.|                
Zfish   399 PKNDCRSCLIQQDPYCGWCVREGRCTRKKNCNKGEGENVWL-WGPDQAC---------------- 446

  Fly   603 SHLHLIIRTLPEPFNAKYRCVFGNSTPIDAEILENGLGCATP 644
                    .:.||.|.: .|:..:.||      .||:  :||
Zfish   447 --------KILEPINFQ-ACIAVDQTP------PNGM--STP 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PlexBNP_001245400.1 Sema_plexin_like 86..534 CDD:200497 107/450 (24%)
PSI 535..586 CDD:279745 19/50 (38%)
PSI 683..730 CDD:214655
PSI 836..877 CDD:214655
IPT_plexin_repeat1 888..976 CDD:238585
IPT_plexin_repeat2 977..1095 CDD:238584
IPT_plexin_repeat3 1097..1211 CDD:238586
Plexin_cytopl 1452..2017 CDD:285529
plxnb2a.2NP_001107960.1 Sema 1..395 CDD:301699 107/450 (24%)
PSI 397..440 CDD:279745 17/43 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10728
eggNOG 1 0.900 - - E1_KOG3610
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100269
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.