DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mod and Pabpc5

DIOPT Version :9

Sequence 1:NP_001247401.1 Gene:mod / 43764 FlyBaseID:FBgn0002780 Length:542 Species:Drosophila melanogaster
Sequence 2:NP_444344.1 Gene:Pabpc5 / 93728 MGIID:2136401 Length:381 Species:Mus musculus


Alignment Length:266 Identity:56/266 - (21%)
Similarity:113/266 - (42%) Gaps:46/266 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 VFVTNLPNEYLHKDLVALFAKFGRLSALQRFTNLNGNKS-VLIAFDTSTGAEAVLQAKPKALTLG 240
            :|:.||.....::.|..||:.||.:.:.:...:.||:|. ..:.||:...|...:. ....:.|.
Mouse   107 IFIKNLDKTIDNRALFYLFSAFGNILSCKVVCDDNGSKGYAYVHFDSLAAANRAIW-HMNGVRLN 170

  Fly   241 DNVLSV----------SQPRNKEENNERTVVVGLIGPNITKDDLKTFFEKVAPVEAVTI---SSN 292
            :..:.|          ::.|.:|......|.|...|.:|..:.|...|.:..|.|:|.:   ::.
Mouse   171 NRQVYVGRFKFPEERAAEVRTRERATFTNVFVKNFGDDIDDEKLNKLFSEYGPTESVKVIRDATG 235

  Fly   293 RLMPRAFVRLASVDDIPKA-LKLHSTELFSRFITVRRISQESISRTSEL---------------- 340
            :.....|||..:.:...|| |:||...:..:.:.|.| :|:.|.|.:||                
Mouse   236 KSKGFGFVRYETHEAAQKAVLELHGKSIDGKVLCVGR-AQKKIERLAELRRRFERLKLKEKNRPS 299

  Fly   341 --TLVVENVGKHESYSSDALEKIFKKFGDVEEIDVVCSK------AVLAFVTFKQSDAATKALAQ 397
              .:.::|:  .|:.:.:.|::.|..||.:....|:...      .|:.|.:|::   |.||:.:
Mouse   300 GVPIYIKNL--DETINDEKLKEEFSSFGSISRAKVMMEVGQGKGFGVVCFSSFEE---ACKAVDE 359

  Fly   398 LDGKTV 403
            ::|:.:
Mouse   360 MNGRII 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modNP_001247401.1 RRM_SF 177..244 CDD:302621 15/67 (22%)
RRM_SF 260..327 CDD:240668 17/70 (24%)
RRM_SF 342..411 CDD:240668 14/68 (21%)
RRM_SF 422..>465 CDD:302621
Pabpc5NP_444344.1 RRM1_I_PABPs 21..97 CDD:240824
ELAV_HUD_SF 28..270 CDD:273741 35/163 (21%)
RRM2_I_PABPs 103..178 CDD:240825 16/71 (23%)
RRM3_I_PABPs 197..276 CDD:240826 20/79 (25%)
RRM_SF 300..376 CDD:302621 14/71 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.