DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mod and CG5213

DIOPT Version :9

Sequence 1:NP_001247401.1 Gene:mod / 43764 FlyBaseID:FBgn0002780 Length:542 Species:Drosophila melanogaster
Sequence 2:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster


Alignment Length:115 Identity:24/115 - (20%)
Similarity:53/115 - (46%) Gaps:12/115 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   351 ESYSSDALEKIFKKFGDVEEIDVV--------CSKAVLAFVTFKQSDAATKAL--AQLDGKTVNK 405
            :..:...|.::|.|||::.:..::        |....:.:|:.:|:.||...:  .:..||.:..
  Fly    50 QDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQAAAAVNGMDGYETRGKRLKV 114

  Fly   406 FEWKLHRFERSTSGRAILVTNLTSDATEADLRKVFNDSGEIESIIMLGQK 455
            ...:...:|.::|  ::.|.||.:...|..:|::|...|.|..:.:|..|
  Fly   115 AFA
RPSEYESTSS--SLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHK 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modNP_001247401.1 RRM_SF 177..244 CDD:302621
RRM_SF 260..327 CDD:240668
RRM_SF 342..411 CDD:240668 12/69 (17%)
RRM_SF 422..>465 CDD:302621 10/34 (29%)
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 12/66 (18%)
RRM 128..202 CDD:214636 10/35 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439583
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23147
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.