DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mod and CG3335

DIOPT Version :9

Sequence 1:NP_001247401.1 Gene:mod / 43764 FlyBaseID:FBgn0002780 Length:542 Species:Drosophila melanogaster
Sequence 2:NP_648337.1 Gene:CG3335 / 39119 FlyBaseID:FBgn0036018 Length:918 Species:Drosophila melanogaster


Alignment Length:645 Identity:138/645 - (21%)
Similarity:244/645 - (37%) Gaps:163/645 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QKKAVTVKGKKATNGEEKPLA---------KRVTKSTKVQEEETVVPQSPSKKSRKQPVKEVPQF 58
            |...|.|:...|...|:||.:         |.:.|..:.:.|.....:...||.:|..|.:|.|.
  Fly    68 QTSRVRVESCAALGSEDKPQSWSKYAKDSKKNLDKLKEKEREAAAKAKESEKKKKKDKVDKVDQI 132

  Fly    59 SEEDESDVE-----EQNDEQP-------GDDSDFETEEAAGLIDDEAEEDEEYNSDDEEDDDDDE 111
            ....:.|.|     |.:|:..       |.:.:.|.||.    |||.:|:.....||...|.|..
  Fly   133 LSRHKDDPEFQEFLEAHDKSRTLWGNDLGINKNRENEEE----DDEEQEESRAARDDSGVDADAG 193

  Fly   112 LEPGEVSKSEGADEVDESDDDEEAPVEKPVS-----------------KKSEKANSEKSEENRGI 159
            .|.|      ..||.||.:|.::. .|||:|                 .|..||.::||  |..:
  Fly   194 DEDG------SGDEADEEEDTDKL-AEKPISDLEYMKSLMATTSGEATAKKPKAKADKS--NLEL 249

  Fly   160 PKVKVGKIPLGTPKNQIV--------FVTNLPNEYLHKDLVALFAKFGRLSALQRFTNLNGNKSV 216
            ..:|:..:|..|.:.:::        :...||::      |..|...|..:.......:..|||.
  Fly   250 FTIKIHNVPYNTKRQEVLKFFKPLKPYSVRLPSK------VHGFCYVGFKTEKDMAKGMLKNKSF 308

  Fly   217 L----IAFDTSTGAEAVLQAK-------PKALTLGDNVLSVSQPR-NKEENNERT--VVVGLIGP 267
            :    :.|...|....|.:|.       |.|:..|:......|.. :||::...:  :....:..
  Fly   309 IKGKQVFFSDFTEKNKVTKASKSGQPLAPAAVDAGNAKWKHQQDSLSKEDDISESGRIFFRNLAY 373

  Fly   268 NITKDDLKTFFEKVAPVEAVTISSNRL-------------MPRAFVRLASVDDIPKALK----LH 315
            ..|::||:..||:..||..|.:..::|             ||.            .|||    |.
  Fly   374 TTTEEDLRKLFEQFGPVVEVNLPLDKLTRKIKGFGTVTYMMPE------------HALKAFNTLD 426

  Fly   316 STELFSRFITVRRISQESISRTSELTLVVENVGKHESYSSDALEKIFKKFGDVEE---------- 370
            .|:...|.:.:  :..:.|.:..:     |::.::::..|...:|..|...:.::          
  Fly   427 GTDFHGRLLHL--LPSKDIEKNPK-----EDLDENDASLSFKEKKALKLKKNAQKPIGWNTLFLG 484

  Fly   371 IDVVCSKAVLAFVTFKQ-----SDAATKALAQLD-GKTVNKFEWK---------LHRFE---RST 417
            .:.|.......|.|.|:     ||..:.|..:|. |:|....|.|         |..|:   :..
  Fly   485 ANAVAEILAKQFKTSKERILDTSDGGSSAAVRLALGETQVVIEMKRFLEEEGVRLDAFDEPAKKR 549

  Fly   418 SGRAILVTNLTSDATEADLRKVFNDSGEIESIIM--LGQKAVVKFKDD----EGFCKSFLANESI 476
            |...||..||.:....:::..:|:..|.|..|::  .|..|::::.|.    :.|.|  || .|.
  Fly   550 SNTVILAKNLPAATEISEITPIFSRFGPIGRIVLPPSGVTALIEYCDPLEARQAFKK--LA-YSK 611

  Fly   477 VNNAPIFIEPNSLLKHRLLKKRLAIGQTRAPR---KFQKDTKPNFGKKPF--NKRPAQEN 531
            ..|||:::|   ....::..|.|: |:...|:   |.:::.||.  :||.  :.:|.:|:
  Fly   612 FKNAPLYLE---WAPEQVFTKTLS-GEPVIPKSEPKPKEEVKPE--EKPIVNDAKPDEED 665

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modNP_001247401.1 RRM_SF 177..244 CDD:302621 15/85 (18%)
RRM_SF 260..327 CDD:240668 17/83 (20%)
RRM_SF 342..411 CDD:240668 16/93 (17%)
RRM_SF 422..>465 CDD:302621 11/48 (23%)
CG3335NP_648337.1 RRM1_RBM19 2..77 CDD:241008 3/8 (38%)
RRM_SF 250..314 CDD:302621 11/69 (16%)
RRM3_RBM19 362..440 CDD:241011 17/91 (19%)
RRM4_RBM19 552..623 CDD:241013 20/76 (26%)
RRM <638..845 CDD:223796 8/30 (27%)
RRM5_RBM19_like 679..760 CDD:240764
RRM6_RBM19 785..864 CDD:241015
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23147
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.