DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mod and TBPH

DIOPT Version :9

Sequence 1:NP_001247401.1 Gene:mod / 43764 FlyBaseID:FBgn0002780 Length:542 Species:Drosophila melanogaster
Sequence 2:NP_001163280.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster


Alignment Length:291 Identity:62/291 - (21%)
Similarity:105/291 - (36%) Gaps:74/291 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 DEVDESDDDEEAPVEKPVSKKSEKANSEKSEENRGIPKVKVGKIPLGTPKNQIVFVTNLPNEYLH 188
            |.|..|:::.:.|:|.|            :||:        |.:.|.|.:.|  |..:...:|.:
  Fly     2 DFVQVSEEEGDEPIELP------------AEED--------GTLLLSTLQAQ--FPGSCGLKYRN 44

  Fly   189 KDLVALFAKFGRLSALQRFTNLNGNKSVLIAFDTSTGAEAVLQAKPKALTLGDNVLSVSQPRNKE 253
            .|..|:           |....|..:....:.::..|..|.....||           ...|..:
  Fly    45 LDTKAV-----------RGVRSNEGRLFPPSVESGWGEYAYFCVFPK-----------ENKRKSD 87

  Fly   254 ENNERT----------------VVVGLIGP-NITKDDLKTFFEKVAPVEAVTI----SSNRLMPR 297
            :|.|.:                :|:||  | ..|::.|:.:||....|....|    .|.:....
  Fly    88 DNLENSTAKTKRIETRLRCTDLIVLGL--PWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGF 150

  Fly   298 AFVRLASVDDIPKAL-KLHSTELFSRFITVRRISQESISRTSELTLVVENVGK-HESYSSDALEK 360
            .|||..|.|...:.| ..|..:  .|:..|:..:.:.:.......:.   ||: .|..:||.|.:
  Fly   151 GFVRFGSYDAQMRVLTNRHLID--GRWCEVKVPNSKGMGHQVPCKVF---VGRCTEDINSDDLRE 210

  Fly   361 IFKKFGDVEEIDVVCSKAVLAFVTFKQSDAA 391
            .|.|||:|.::.:.......:||||...|.|
  Fly   211 YFSKFGEVTDVFIPRPFRAFSFVTFLDPDVA 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modNP_001247401.1 RRM_SF 177..244 CDD:302621 10/66 (15%)
RRM_SF 260..327 CDD:240668 19/72 (26%)
RRM_SF 342..411 CDD:240668 17/51 (33%)
RRM_SF 422..>465 CDD:302621
TBPHNP_001163280.1 RRM1_TDP43 108..184 CDD:240767 20/79 (25%)
RRM2_TDP43 192..261 CDD:240768 17/53 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439638
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.