DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mod and pAbp

DIOPT Version :9

Sequence 1:NP_001247401.1 Gene:mod / 43764 FlyBaseID:FBgn0002780 Length:542 Species:Drosophila melanogaster
Sequence 2:NP_476667.1 Gene:pAbp / 37070 FlyBaseID:FBgn0265297 Length:634 Species:Drosophila melanogaster


Alignment Length:294 Identity:65/294 - (22%)
Similarity:113/294 - (38%) Gaps:54/294 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 VFVTNLPNEYLHKDLVALFAKFGRLSALQRFTNLNGNKS--VLIAFDTSTGAEAVLQAKPKALTL 239
            ||:.||.....:|.:...|:.||.:.:.:..|:..||..  ..:.|:|...|...:. |...:.|
  Fly    92 VFIKNLDRAIDNKAIYDTFSAFGNILSCKVATDEKGNSKGYGFVHFETEEAANTSID-KVNGMLL 155

  Fly   240 GDNVLSVS-----QPRNKEENNERTVVVGLIGPNITKD----DLKTFFE---KVAPVEAVTISSN 292
            ....:.|.     :.|.||...:..:...:...|.|:|    .||.|||   |:...:.::....
  Fly   156 NGKKVYVGKFIPRKEREKELGEKAKLFTNVYVKNFTEDFDDEKLKEFFEPYGKITSYKVMSKEDG 220

  Fly   293 RLMPRAFVRLASVDDIPKALK-LHSTEL-FSRFITVRRISQESISRTSELTLVVENV--GKHES- 352
            :.....||...:.:....|:: |:..:: ..:.:.|.| :|:...|..||....|.:  .:||| 
  Fly   221 KSKGFGFVAFETTEAAEAAVQALNGKDMGEGKSLYVAR-AQKKAERQQELKRKFEELKQKRHESV 284

  Fly   353 -------------YSSDALEKIFKKFGDVEEIDVVC-----SKAVLAFVTFKQSDAATKALAQLD 399
                         ...|.|...|..:|::....|:.     ||. ..||.|..:..||.|:.:|:
  Fly   285 FGVNLYVKNLDDTIDDDRLRIAFSPYGNITSAKVMTDEEGRSKG-FGFVCFNAASEATCAVTELN 348

  Fly   400 GKTV-----------NKFEWKLH---RFERSTSG 419
            |:.|           .|.|.|.|   ::.|..:|
  Fly   349 GRVVGSKPLYVALAQRKEERKAHLASQYMRHMTG 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modNP_001247401.1 RRM_SF 177..244 CDD:302621 16/68 (24%)
RRM_SF 260..327 CDD:240668 13/75 (17%)
RRM_SF 342..411 CDD:240668 23/100 (23%)
RRM_SF 422..>465 CDD:302621
pAbpNP_476667.1 PABP-1234 2..625 CDD:130689 65/294 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439609
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.