DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mod and Spx

DIOPT Version :9

Sequence 1:NP_001247401.1 Gene:mod / 43764 FlyBaseID:FBgn0002780 Length:542 Species:Drosophila melanogaster
Sequence 2:NP_511058.1 Gene:Spx / 31558 FlyBaseID:FBgn0015818 Length:347 Species:Drosophila melanogaster


Alignment Length:219 Identity:48/219 - (21%)
Similarity:90/219 - (41%) Gaps:40/219 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 EENNERTVVVGLIGPNITKDDLKTFFEKVAPVEAVTISSNRLMPR----AFVRLASVDDIPKALK 313
            |.|.:.|:..|.:...:::..|...|.:..||..|.:..:|:...    .||...|.:|....:|
  Fly     8 ERNQDATIYAGGLDDKVSETLLWELFVQAGPVVNVHMPKDRVTQMHQGYGFVEFLSEEDADYGIK 72

  Fly   314 -LHSTELFSRFITVRRISQESISRTSELTLVVENVGKHESYSSDALEKI----FKKFGDVEEIDV 373
             ::..:|:.:.|.|.:.|....:......:.:.|:      ..:..||:    |..||.:.:...
  Fly    73 IMNMIKLYGKPIRVNKASAHQKNLDVGANIFIGNL------DVEVDEKLLYDTFSAFGVILQTPK 131

  Fly   374 VC---------SKAVLAFVTFKQSDAATKALAQLDGK-------TVNKFEWKLHRFER--STSGR 420
            :.         |.|.:.|.:|:.||||..|   ::|:       :|:....|.|:.||  |.:.|
  Fly   132 IMRDPETGKSKSFAFINFASFEASDAAMDA---MNGQYLCNRPISVSYAFKKDHKGERHGSAAER 193

  Fly   421 AILVTNLTSDATEADL-RKVFNDS 443
            .:...|   .:|.||. .::|.|:
  Fly   194 LLAAQN---PSTHADRPHQLFADA 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modNP_001247401.1 RRM_SF 177..244 CDD:302621
RRM_SF 260..327 CDD:240668 14/71 (20%)
RRM_SF 342..411 CDD:240668 18/88 (20%)
RRM_SF 422..>465 CDD:302621 6/23 (26%)
SpxNP_511058.1 RRM1_SF3B4 15..88 CDD:240780 15/72 (21%)
RRM2_SF3B4 99..181 CDD:240781 17/90 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439632
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.