DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mod and Pabpc2

DIOPT Version :9

Sequence 1:NP_001247401.1 Gene:mod / 43764 FlyBaseID:FBgn0002780 Length:542 Species:Drosophila melanogaster
Sequence 2:NP_001099621.1 Gene:Pabpc2 / 291615 RGDID:1310759 Length:630 Species:Rattus norvegicus


Alignment Length:265 Identity:62/265 - (23%)
Similarity:111/265 - (41%) Gaps:45/265 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 VFVTNLPNEYLHKDLVALFAKFGRLSALQRFTNLNGNKS-VLIAFDTSTGAEAVLQAKPKALTLG 240
            ||:.||.....:|.|...|:.||.:.:.:...:.||:|. ..:.|:|...||..:: |...:.|.
  Rat   101 VFIKNLNKTIDNKALYDTFSAFGNILSCKVVCDENGSKGHGFVHFETEEAAERAIE-KMNGMLLN 164

  Fly   241 DNVLSVSQPRNKEENNERTVVVGLIGPNITKDDLKTF---------------FEKVAPVEAVTIS 290
            |..:.|.|.::::   ||...:|......|...:|.|               |.:|..|:.:|..
  Rat   165 DRKVFVGQFKSRK---EREAELGTRTKEFTNVYIKNFGDRMDDKTLNGLFGRFGQVLSVKVMTDE 226

  Fly   291 SNRLMPRAFVRLASVDDIPKAL-KLHSTELFSRFITV-----------------RRISQESISRT 337
            ..:.....||.....:|..||: :::..||..:.|.|                 .:::|:...|.
  Rat   227 GGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKHIYVGPAQKKVDRHIELKRKFEQVTQDRGIRY 291

  Fly   338 SELTLVVENVGKHESYSSDALEKIFKKFGDVEEIDVVC----SKAVLAFVTFKQSDAATKALAQL 398
            ..:.|.|:|:  .:....:.|:|.|..||.:....|:.    ||. ..||.|...:.||||::::
  Rat   292 QGINLYVKNL--DDGIDDERLQKEFSPFGTITSTKVMTEGGRSKG-FGFVCFSSPEEATKAVSEM 353

  Fly   399 DGKTV 403
            :|:.|
  Rat   354 NGRIV 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modNP_001247401.1 RRM_SF 177..244 CDD:302621 19/67 (28%)
RRM_SF 260..327 CDD:240668 17/99 (17%)
RRM_SF 342..411 CDD:240668 20/66 (30%)
RRM_SF 422..>465 CDD:302621
Pabpc2NP_001099621.1 PABP-1234 11..609 CDD:130689 62/265 (23%)
RRM1_I_PABPs 12..91 CDD:240824
RRM2_I_PABPs 97..171 CDD:240825 19/70 (27%)
RRM3_I_PABPs 190..269 CDD:240826 16/78 (21%)
RRM4_I_PABPs 293..370 CDD:240827 20/69 (29%)
PABP 542..608 CDD:279051
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.