DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mod and Pabpc4

DIOPT Version :9

Sequence 1:NP_001247401.1 Gene:mod / 43764 FlyBaseID:FBgn0002780 Length:542 Species:Drosophila melanogaster
Sequence 2:NP_570951.2 Gene:Pabpc4 / 230721 MGIID:2385206 Length:660 Species:Mus musculus


Alignment Length:305 Identity:69/305 - (22%)
Similarity:122/305 - (40%) Gaps:60/305 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 SEENRGIPKVKVGKIPLGTPKNQIVFVTNLPNEYLHKDLVALFAKFGRLSALQRFTNLNGNKS-V 216
            |:.:..:.|..||.          ||:.||.....:|.|...|:.||.:.:.:...:.||:|. .
Mouse    87 SQRDPSLRKSGVGN----------VFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYA 141

  Fly   217 LIAFDTSTGAEAVLQAKPKALTLGDNVLSVSQPRNKEENNER---------TVVVGLIGPNITKD 272
            .:.|:|...|:..:: |...:.|.|..:.|.:.::::|....         .|.:...|..:...
Mouse   142 FVHFETQEAADKAIE-KMNGMLLNDRKVFVGRFKSRKEREAELGAKAKEFTNVYIKNFGEEVDDG 205

  Fly   273 DLKTFFE---KVAPVEAVTISSNRLMPRAFVRLASVDDIPKAL-KLHSTELFSRFITVRR----- 328
            :||..|.   |...|:.:..||.:.....||.....:|..||: :::..|:..:.|.|.|     
Mouse   206 NLKELFSQFGKTLSVKVMRDSSGKSKGFGFVSYEKHEDANKAVEEMNGKEMSGKAIFVGRAQKKV 270

  Fly   329 ------------ISQESISRTSELTLVVENVGKHESYSSDALEKIFKKFGDVEEIDVVC----SK 377
                        :.||.|||...:.|.::|:  .::...:.|.:.|..||.:....|:.    ||
Mouse   271 ERQAELKRKFEQLKQERISRYQGVNLYIKNL--DDTIDDEKLRREFSPFGSITSAKVMLEDGRSK 333

  Fly   378 AVLAFVTFKQSDAATKALAQLDGKTV-----------NKFEWKLH 411
            . ..||.|...:.||||:.:::|:.|           .|.|.|.|
Mouse   334 G-FGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEERKAH 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
modNP_001247401.1 RRM_SF 177..244 CDD:302621 18/67 (27%)
RRM_SF 260..327 CDD:240668 16/70 (23%)
RRM_SF 342..411 CDD:240668 21/83 (25%)
RRM_SF 422..>465 CDD:302621
Pabpc4NP_570951.2 PABP-1234 11..640 CDD:130689 69/305 (23%)
RRM1_I_PABPs 12..91 CDD:240824 1/3 (33%)
RRM2_I_PABPs 97..172 CDD:240825 21/85 (25%)
RRM3_I_PABPs 190..269 CDD:240826 18/78 (23%)
RRM4_I_PABPs 293..370 CDD:240827 18/79 (23%)
PABP 572..639 CDD:279051
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.